Property Summary

NCBI Gene PubMed Count 28
PubMed Score 58.72
PubTator Score 39.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
PARKINSON DISEASE 19A, JUVENILE-ONSET 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Disseminated intravascular coagulation 38 0.0 2.2

Expression

  Differential Expression (20)

Disease log2 FC p
Parkinson's disease -1.200 3.1e-02
active Crohn's disease 1.172 4.8e-02
adult high grade glioma -2.600 2.2e-08
astrocytic glioma -2.300 2.3e-03
Astrocytoma, Pilocytic -1.800 7.8e-09
atypical teratoid / rhabdoid tumor -5.300 1.4e-07
chronic rhinosinusitis -1.127 2.5e-03
cystic fibrosis -2.284 1.5e-07
ependymoma -3.700 9.4e-03
glioblastoma -2.500 5.6e-08
group 3 medulloblastoma -1.100 9.9e-04
intraductal papillary-mucinous adenoma (... -1.200 1.2e-02
intraductal papillary-mucinous neoplasm ... -2.000 2.1e-02
lung cancer 1.500 2.6e-02
lung carcinoma 2.700 5.8e-49
medulloblastoma, large-cell -2.000 8.2e-07
oligodendroglioma -1.800 1.8e-02
osteosarcoma -3.865 1.4e-05
primitive neuroectodermal tumor -2.100 4.6e-03
subependymal giant cell astrocytoma -2.236 2.2e-02

Gene RIF (13)

AA Sequence

MKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGDLDFTYVT      1 - 70
SRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHN     71 - 140
LFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAIRLLYAKRPGIGLSPSHRR    141 - 210
YLGYMCDLLADKPYRPHFKPLTIKSITVSPIPFFNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQ    211 - 280
DGKIFIPLNITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVP    281 - 350
EKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHY    351 - 420
GQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAA    421 - 490
PPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP    491 - 560
RRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVN    561 - 630
IQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGL    631 - 700
GGGFPPLSSPQKASPQPMGGGWQQGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGS    701 - 770
SNLEGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTM    771 - 840
HTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQK    841 - 910
PLY                                                                       911 - 913
//

Text Mined References (35)

PMID Year Title