Property Summary

NCBI Gene PubMed Count 35
PubMed Score 78.85
PubTator Score 40.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Obesity 678 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis 1.252 3.3e-03
astrocytoma 2.800 1.2e-02
Astrocytoma, Pilocytic 1.300 9.8e-05
Gaucher disease type 1 1.300 3.5e-02
medulloblastoma -1.200 1.2e-05
medulloblastoma, large-cell -2.900 3.9e-05
psoriasis -1.700 4.9e-03

Gene RIF (32)

AA Sequence

MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSF      1 - 70
PDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPAT     71 - 140
SPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVPATVATATPSTPAAPPFTATTAVIRTTGVRR    141 - 210
LLPLPLTTVATARATTPEAPSPPTTAAVLDTEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGT    211 - 280
TAPGPTEVAQTPTPETFLTTIRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTL    281 - 350
PKGARPGPGLLDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT    351 - 420
LEEPKQASVTYQKPDKQEEFYA                                                    421 - 442
//

Text Mined References (36)

PMID Year Title