Property Summary

NCBI Gene PubMed Count 34
Grant Count 60
R01 Count 44
Funding $6,898,212.56
PubMed Score 73.26
PubTator Score 40.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.700 0.005
sonic hedgehog group medulloblastoma -1.300 0.001
astrocytoma 2.800 0.012
medulloblastoma, large-cell -2.900 0.000
active ulcerative colitis 1.252 0.003
pilocytic astrocytoma 1.300 0.000
Gaucher disease type 1 1.300 0.035

Synonym

Accession O75056 Q5T1Z6 Q5T1Z7 Q96CT3 Q96PR8 SYND3
Symbols SDCN
SYND3

Gene

Gene RIF (32)

PMID Text
25617766 Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells
24956062 Data indicate that the extracellular and cytoplasmic domains of syndecans 1/2/3/4 are intrinsically disordered regions.
24659893 frequently expressed in pancreatic cancer and associated with perineural invasion
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
23351331 Syndecan-3 expression was not associated with disease progression and outcome in specific subtypes of mammary carcinoma.
22721673 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
21555518 SDC3 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21200028 Syndecan-3 may directly transduce Glial cell line-derived neurotrophic factor (GDNF) family ligands (GFL) signals or serve as a coreceptor, presenting GFLs to the signaling receptor RET.
21050724 Observational study of gene-disease association. (HuGE Navigator)
19822079 Data report that the bFGF, FGFR1/2 and syndecan 1-4 expressions are altered in bladder tumours.
More...

AA Sequence

MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSF      1 - 70
PDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPAT     71 - 140
SPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVPATVATATPSTPAAPPFTATTAVIRTTGVRR    141 - 210
LLPLPLTTVATARATTPEAPSPPTTAAVLDTEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGT    211 - 280
TAPGPTEVAQTPTPETFLTTIRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTL    281 - 350
PKGARPGPGLLDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT    351 - 420
LEEPKQASVTYQKPDKQEEFYA                                                    421 - 442
//

Text Mined References (35)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25617766 2015 Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells.
24956062 2015 Cell communication using intrinsically disordered proteins: what can syndecans say?
24659893 2014 Midkine promotes perineural invasion in human pancreatic cancer.
23395182 2013 The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
23351331 2013 Prognostic significance of the expression of GFR?1, GFR?3 and syndecan-3, proteins binding ARTEMIN, in mammary carcinoma.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21200028 2011 Heparan sulfate proteoglycan syndecan-3 is a novel receptor for GDNF, neurturin, and artemin.
21050724 2011 Clock genes and body composition in patients with schizophrenia under treatment with antipsychotic drugs.
19822079 Expression of basic fibroblast growth factor, its receptors and syndecans in bladder cancer.
More...