Property Summary

NCBI Gene PubMed Count 88
PubMed Score 133.37
PubTator Score 140.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group B ependymoma -1.500 3.1e-09
glioblastoma -1.200 3.2e-09
sonic hedgehog group medulloblastoma -1.700 3.1e-07
atypical teratoid / rhabdoid tumor -1.500 2.1e-06
primitive neuroectodermal tumor -1.100 8.4e-03
pediatric high grade glioma -1.100 3.4e-07
pilocytic astrocytoma -1.400 2.7e-09
lung carcinoma 1.800 1.7e-38

Synonym

Accession O75052 B7ZLF5 O43564 Q3T551 Q5VU95
Symbols CAPON
6330408P19Rik

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (93)

PMID Text
26384012 Results suggest that NOS1AP variants are associated with various forms of depression in schizophrenia and are more prevalent in males.
26332198 SNPs in the NOS1AP gene influence QTc interval duration but we have not demonstrated a direct association with the risk of sudden cardiac death
25639344 The study suggested that rs3751284 and rs348624 in the NOS1AP gene might be susceptibility loci for sudden unexplained death during daily activities.
24857694 We further localized NOS1AP to cardiomyocyte intercalated discs (IDs) and demonstrate that overexpression of NOS1AP in cardiomyocytes leads to altered cellular electrophysiology.
24504561 report of the association of common NOS1AP polymorphisms with sudden unexplained nocturnal death syndrome in the southern Chinese Han population. These findings suggest that the A allele of rs12567209 and haplotype GCTA may serve as a protective modifier.
24418727 The A allele of rs12567209 in NOS1AP may serve as an independent predictor of all-cause death and SCD in patients with CHF.
24220657 This study suggested that NOS1 and NOS1AP were associated with schizophrenia.
23347024 In atherosclerosis, NOS1AP variants were associated with QT in CAU, with weaker evidence for selected variants in HIS and CHN. Location of significant SNPs varied across ancestry.
23171141 rs10918859 of the NOS1AP gene is associated with CHD in Han Chinese. In addition, here we report a gender effect in the association between rs10918859 of the NOS1AP gene and CHD.
23146198 This is the first study reporting that a variant of the NOS1AP gene is associated with PTSD. Our data also suggest that a genetic variant in NOS1AP may increase the susceptibility to severe depression in patients with PTSD and increased risk for suicide.
22682551 Common variations in the NOS1AP gene are associated with a significant increase in the risk of drug-induced long QT syndrome.
22179838 NOS1AP colocalizes with both SCRIB and VANGL1 along cellular protrusions in metastatic breast cancer cells, but does not colocalize with either SCRIB or VANGL1 at cell junctions in normal breast cells
22019493 Decreased NOS1AP expression in rs10494366 TT and rs10918594 CC homozygotes may underlie shorter repolarization times.Myocardial tissue for gene expression analysis was obtained from extracted cardiac implantable electronic device.
21996201 NOS1AP rs203462 polymorphisms did not correlate with an increased risk of QT interval prolongation among kidney recipients.
21959512 relationship of nitric oxide synthase 1 adaptor protein (NOS1AP) polymorphism with serum creatinine level and occurrence of delayed graft function in kidney transplant recipients
21685173 Common variations in or near CASQ2, GPD1L, and NOS1AP are associated with increased risk of sudden cardiac death in patients with coronary artery disease
20921969 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20921115 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20722683 The genetic variant rs12143842 in NOS1AP is associated with QT interval duration in a Chinese population with Type 2 diabetes.
20722683 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605702 Data show that NOS1AP protein levels are altered in BA46 and cerebellum of patients with schizophrenia.
20602773 Two non-synonymous NOS1AP variations, V37I and D423N were identified in two families, one with two siblings with Obsessive-Compulsive Disorder and the other with two brothers with autism spectrum disorders.
20602773 Observational study of gene-disease association. (HuGE Navigator)
20541371 Observational study of gene-disease association. (HuGE Navigator)
20538168 NOS1AP tag SNP genotype may provide an additional clinical dimension, which helps assess risk and choice of therapeutic strategies in LQTS.
20538168 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20305679 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20215044 NOS1AP has a modest effect on ECG t-wave peak to t-wave end interval but is not related to T-wave morphology measures.
20215044 Observational study of gene-disease association. (HuGE Navigator)
20031603 The length of QT interval verify the importance of NOS1AP protein and to identify a SNP on chromosome 13 reaching genome-wide significance.
20031603 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19943157 the NOS1AP variant is associated with incidence of type 2 diabetes in calcium channel blocker users
19943157 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19937226 NOS1AP variants may not play a dominant role in susceptibility to type 2 diabetes, but a minor effect cannot be excluded.
19937226 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19822806 Association of NOS1AP genetic variants with risk for life-threatening arrhythmias suggests that this gene is a genetic modifier of the long-QT syndrome.
19822806 Observational study of gene-disease association. (HuGE Navigator)
19800018 these findings support the hypothesis that NOS1 redistribution in injured myocardium requires the formation of a complex with the PDZ adaptor protein CAPON.
19643915 Study provided additional evidence for association between genetic variation within NOS1AP and SCD.
19643915 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19587794 Meta-analysis and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19553464 CPE mediates the effects of NOS1AP on dendrite morphology.
19339362 We do not know yet just how major a role NOS1AP will prove to play outside these Canadian families, but the replicated associations and the postmortem work suggest that the role may be more major than appreciated until now.
19305409 Genome-wide association study of gene-disease association. (HuGE Navigator)
19305408 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19289301 Sequence analysis revealed that one non-synonymous substitution in exon 8 was observed in one subject, in addition to six SNPs in exons and introns. This study showed variations in NOS1AP might be involved in occurrence of SIDS
19289301 Observational study of gene-disease association. (HuGE Navigator)
19255043 The A allele of rs12742393 appears to be a risk allele associated with schizophrenia that acts by enhancing transcription factor binding and increasing gene expression.
19247217 The minor alleles of both NOS1AP single nucleotide polymorphisms significantly potentiate the QTc prolonging effect of verapamil.
19247217 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19204306 sequence variations in NOS1AP were associated with baseline QT interval and the risk of sudden cardiac death in white US adults.
19204306 Observational study of gene-disease association. (HuGE Navigator)
19180230 These data extend the association of genetic variants in NOS1AP with QT interval to a Black population...In addition, we identify a strong sex-interaction and the presence of a second independent site within NOS1AP associated with the QT interval.
19180230 Observational study of gene-disease association. (HuGE Navigator)
19111066 We failed to provide evidence of an association between NOS1AP rs7538490 and type 2 diabetes, overweight, obesity or related quantitative metabolic phenotypes in large-scale studies of Danes
19111066 Observational study of gene-disease association. (HuGE Navigator)
19077434 study found significant association between eight SNPs in the NOS1AP gene region to schizophrenia (patients from a South American population isolate) and its clinical dimensions
19077434 Observational study of gene-disease association. (HuGE Navigator)
19076153 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19019189 Observational study of gene-disease association. (HuGE Navigator)
18927126 A common variant (rs10494366T > G) within NOS1AP gene was associated with QT-interval duration.
18927126 Observational study of gene-disease association. (HuGE Navigator)
18785031 Demonstrated that the common NOS1AP variant rs10494366 was associated with increased QT interval in healthy young adults.
18785031 Observational study of gene-disease association. (HuGE Navigator)
18766325 Single nucleotide polymorphisms are associated with incidence of diabetes mellitus in people who use calcium channel blockers.
18766325 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18551039 Common variation in the NOS1AP gene is associated with reduced glucose-lowering effect and with increased mortality in users of sulfonylurea.
18551039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18511491 Observational study of gene-disease association. (HuGE Navigator)
18474209 Linkage and association studies from multiple samples drawn from different populations indicate that a schizophrenia susceptibility gene is located in the region of chromosome 1 containing NOS1AP.
18430503 Our results identified no single marker nor haplotype associated with schizophrenia, which did not suggest that CAPON was a susceptible site in the Chinese Han population.
18430503 Observational study of gene-disease association. (HuGE Navigator)
18337493 provide a rationale for the association of CAPON gene variants with extremes of the QT interval in human populations
18235038 Strong effects of NOS1AP variants in diabetic individuals suggest that this patient subset may be particularly susceptible to genetic variants that influence myocardial depolarization and repolarization as manifest in the QT interval.
18235038 Observational study of gene-disease association. (HuGE Navigator)
18077426 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17903306 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17576865 Observational study of gene-disease association. (HuGE Navigator)
17565224 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17565224 NOS1AP variants influence QT interval
16648850 Genome-wide association study of gene-disease association. (HuGE Navigator)
16648850 This genome-wide study identified NOS1AP (CAPON), a regulator of neuronal nitric oxide synthase, as a new target that modulates cardiac repolarization
16202394 Observational study of gene-disease association. (HuGE Navigator)
16202394 The present finding weakens the evidence that mutations or variation in the CAPON gene are causing genetic susceptibility to schizophrenia in European populations.
16146415 study adds support to a role of CAPON in schizophrenia, produces new evidence implicating this gene in the etiology of bipolar disorder, and suggests a possible mechanism of action of CAPON in psychiatric illness
15707951 Observational study of gene-disease association. (HuGE Navigator)
15707951 Our findings indicate that CAPON gene may be a candidate susceptibility gene for schizophrenia in Chinese Han population, and also provide further support for the importance of NMDAR-mediated glutamatergic transmission in the etiology of schizophrenia.
11867766 Characterization of the related mouse and rat proteins

AA Sequence

MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKK      1 - 70
KVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNI     71 - 140
FRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERAST    141 - 210
ATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPG    211 - 280
LGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHIS    281 - 350
LLVKQVQELELKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG    351 - 420
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNV    421 - 490
LQRQELGDGLDDEIAV                                                          491 - 506
//

Text Mined References (94)

PMID Year Title
26384012 2015 Association of NOS1AP variants and depression phenotypes in schizophrenia.
26332198 2015 NOS1AP Polymorphisms Modify QTc Interval Duration But Not Cardiac Arrest Risk in Hypertrophic Cardiomyopathy.
25639344 2015 Genetic variants in KCNE1, KCNQ1, and NOS1AP in sudden unexplained death during daily activities in Chinese Han population.
25416956 2014 A proteome-scale map of the human interactome network.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
25055868 2014 Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24857694 2014 An enhancer polymorphism at the cardiomyocyte intercalated disc protein NOS1AP locus is a major regulator of the QT interval.
24665357 2014 NOS1AP modulates intracellular Ca(2+) in cardiac myocytes and is up-regulated in dystrophic cardiomyopathy.
24504561 2014 Association of common variants in NOS1AP gene with sudden unexplained nocturnal death syndrome in the southern Chinese Han population.
24418727 2014 A common NOS1AP genetic polymorphism, rs12567209 G>A, is associated with sudden cardiac death in patients with chronic heart failure in the Chinese Han population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24220657 2014 The genetic contribution of the NO system at the glutamatergic post-synapse to schizophrenia: further evidence and meta-analysis.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23347024 2013 Associations between NOS1AP single nucleotide polymorphisms (SNPs) and QT interval duration in four racial/ethnic groups in the Multi-Ethnic Study of Atherosclerosis (MESA).
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23171141 2013 Positive association between rs10918859 of the NOS1AP gene and coronary heart disease in male Han Chinese.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
23146198 2013 NOS1AP is associated with increased severity of PTSD and depression in untreated combat veterans.
22726844 2012 A common variant in SLC8A1 is associated with the duration of the electrocardiographic QT interval.
22682551 2012 Common variation in the NOS1AP gene is associated with drug-induced QT prolongation and ventricular arrhythmia.
22179838 2012 A protein complex of SCRIB, NOS1AP and VANGL1 regulates cell polarity and migration, and is associated with breast cancer progression.
22019493 2012 Cardiac levels of NOS1AP RNA from right ventricular tissue recovered during lead extraction.
21996201 2011 Association of rs10918594 polymorphisms of nitric oxide synthase 1 adaptor protein (NOS1AP) with QTc interval prolongation during kidney transplantation.
21959512 Association of the rs10918594 of nitric oxide synthase 1 adaptor protein (NOS1AP) polymorphisms with the graft function after kidney transplantation.
21685173 2011 Common variants in CASQ2, GPD1L, and NOS1AP are significantly associated with risk of sudden death in patients with coronary artery disease.
20921969 2012 Genome-wide association study of antipsychotic-induced QTc interval prolongation.
20921115 2010 Biological validation of increased schizophrenia risk with NRG1, ERBB4, and AKT1 epistasis via functional neuroimaging in healthy controls.
20722683 2010 A common variant of NOS1AP is associated with QT interval duration in a Chinese population with Type 2 diabetes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20605702 2010 NOS1AP protein levels are altered in BA46 and cerebellum of patients with schizophrenia.
20602773 2010 Mutation screening of NOS1AP gene in a large sample of psychiatric patients and controls.
20541371 2010 Childhood trauma and genetic factors in familial schizophrenia associated with the NOS1AP gene.
20538168 2010 Polymorphisms in the NOS1AP gene modulate QT interval duration and risk of arrhythmias in the long QT syndrome.
20431962 2010 Human embryonic stem cell-derived neurons as a tool for studying neuroprotection and neurodegeneration.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20305679 2010 A variation in NOS1AP gene is associated with repaglinide efficacy on insulin resistance in type 2 diabetes of Chinese.
20215044 2010 Relationship of common candidate gene variants to electrocardiographic T-wave peak to T-wave end interval and T-wave morphology parameters.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20062063 2010 Several common variants modulate heart rate, PR interval and QRS duration.
20062061 2010 Genetic variation in SCN10A influences cardiac conduction.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19943157 2010 NOS1AP variant associated with incidence of type 2 diabetes in calcium channel blocker users in the Atherosclerosis Risk in Communities (ARIC) study.
19937226 2010 Association of genetic variants of NOS1AP with type 2 diabetes in a Chinese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19822806 2009 NOS1AP is a genetic modifier of the long-QT syndrome.
19800018 Cardiac nitric oxide synthase-1 localization within the cardiomyocyte is accompanied by the adaptor protein, CAPON.
19643915 2009 Genetic variation in NOS1AP is associated with sudden cardiac death: evidence from the Rotterdam Study.
19587794 2009 Common genetic variation near the phospholamban gene is associated with cardiac repolarisation: meta-analysis of three genome-wide association studies.
19553464 2009 NOS1AP regulates dendrite patterning of hippocampal neurons through a carboxypeptidase E-mediated pathway.
19339362 2009 Zeroing in on a schizophrenia gene: a new tool to assess the probability.
19305409 2009 Common variants at ten loci modulate the QT interval duration in the QTSCD Study.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
19255043 2009 Identification of a schizophrenia-associated functional noncoding variant in NOS1AP.
19247217 2009 Calcium channel blockers, NOS1AP, and heart-rate-corrected QT prolongation.
19204306 2009 Genetic variations in nitric oxide synthase 1 adaptor protein are associated with sudden cardiac death in US white community-based populations.
19180230 2009 Multiple independent genetic factors at NOS1AP modulate the QT interval in a multi-ethnic population.
19111066 2008 Lack of association between PKLR rs3020781 and NOS1AP rs7538490 and type 2 diabetes, overweight, obesity and related metabolic phenotypes in a Danish large-scale study: case-control studies and analyses of quantitative traits.
19077434 2009 Evidence for a role of the NOS1AP (CAPON) gene in schizophrenia and its clinical dimensions: an association study in a South American population isolate.
19076153 2009 A common NOS1AP genetic polymorphism is associated with increased cardiovascular mortality in users of dihydropyridine calcium channel blockers.
19019189 2009 Common candidate gene variants are associated with QT interval duration in the general population.
18927126 2009 Identification of a common variant at the NOS1AP locus strongly associated to QT-interval duration.
18785031 2009 Common variation in NOS1AP and KCNH2 genes and QT interval duration in young adults. The Cardiovascular Risk in Young Finns Study.
18766325 2008 Genetic variation in the NOS1AP gene is associated with the incidence of diabetes mellitus in users of calcium channel blockers.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18551039 2008 Common variation in the NOS1AP gene is associated with reduced glucose-lowering effect and with increased mortality in users of sulfonylurea.
18511491 2008 Gender and effects of a common genetic variant in the NOS1 regulator NOS1AP on cardiac repolarization in 3761 individuals from two independent populations.
18474209 2008 NOS1AP in schizophrenia.
18430503 2008 Family-based association studies of CAPON and schizophrenia in the Chinese Han population.
18337493 2008 CAPON modulates cardiac repolarization via neuronal nitric oxide synthase signaling in the heart.
18235038 2008 Association of NOS1AP genetic variants with QT interval duration in families from the Diabetes Heart Study.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18077426 2007 Runs of homozygosity reveal highly penetrant recessive loci in schizophrenia.
17903306 2007 Genome-wide association study of electrocardiographic and heart rate variability traits: the Framingham Heart Study.
17576865 2007 Common NOS1AP variants are associated with a prolonged QTc interval in the Rotterdam Study.
17565224 2007 Associations between genetic variants in the NOS1AP (CAPON) gene and cardiac repolarization in the old order Amish.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16648850 2006 A common genetic variant in the NOS1 regulator NOS1AP modulates cardiac repolarization.
16202394 2006 Failure to confirm allelic association between markers at the CAPON gene locus and schizophrenia in a British sample.
16146415 2005 Increased expression in dorsolateral prefrontal cortex of CAPON in schizophrenia and bipolar disorder.
15707951 2005 Association of the carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase gene with schizophrenia in the Chinese Han population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11867766 2002 Neuronal nitric-oxide synthase localization mediated by a ternary complex with synapsin and CAPON.
11086993 2000 Dexras1: a G protein specifically coupled to neuronal nitric oxide synthase via CAPON.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11043403 2000 The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
9459447 1998 CAPON: a protein associated with neuronal nitric oxide synthase that regulates its interactions with PSD95.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.