Property Summary

NCBI Gene PubMed Count 88
Grant Count 35
R01 Count 20
Funding $5,113,947.58
PubMed Score 133.37
PubTator Score 140.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (93)

PMID Text
26384012 Results suggest that NOS1AP variants are associated with various forms of depression in schizophrenia and are more prevalent in males.
26332198 SNPs in the NOS1AP gene influence QTc interval duration but we have not demonstrated a direct association with the risk of sudden cardiac death
25639344 The study suggested that rs3751284 and rs348624 in the NOS1AP gene might be susceptibility loci for sudden unexplained death during daily activities.
24857694 We further localized NOS1AP to cardiomyocyte intercalated discs (IDs) and demonstrate that overexpression of NOS1AP in cardiomyocytes leads to altered cellular electrophysiology.
24504561 report of the association of common NOS1AP polymorphisms with sudden unexplained nocturnal death syndrome in the southern Chinese Han population. These findings suggest that the A allele of rs12567209 and haplotype GCTA may serve as a protective modifier.
24418727 The A allele of rs12567209 in NOS1AP may serve as an independent predictor of all-cause death and SCD in patients with CHF.
24220657 This study suggested that NOS1 and NOS1AP were associated with schizophrenia.
23347024 In atherosclerosis, NOS1AP variants were associated with QT in CAU, with weaker evidence for selected variants in HIS and CHN. Location of significant SNPs varied across ancestry.
23171141 rs10918859 of the NOS1AP gene is associated with CHD in Han Chinese. In addition, here we report a gender effect in the association between rs10918859 of the NOS1AP gene and CHD.
23146198 This is the first study reporting that a variant of the NOS1AP gene is associated with PTSD. Our data also suggest that a genetic variant in NOS1AP may increase the susceptibility to severe depression in patients with PTSD and increased risk for suicide.
More...

AA Sequence

MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKK      1 - 70
KVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNI     71 - 140
FRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERAST    141 - 210
ATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPG    211 - 280
LGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHIS    281 - 350
LLVKQVQELELKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG    351 - 420
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNV    421 - 490
LQRQELGDGLDDEIAV                                                          491 - 506
//

Text Mined References (94)

PMID Year Title
26384012 2015 Association of NOS1AP variants and depression phenotypes in schizophrenia.
26332198 2015 NOS1AP Polymorphisms Modify QTc Interval Duration But Not Cardiac Arrest Risk in Hypertrophic Cardiomyopathy.
25639344 2015 Genetic variants in KCNE1, KCNQ1, and NOS1AP in sudden unexplained death during daily activities in Chinese Han population.
25416956 2014 A proteome-scale map of the human interactome network.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
25055868 2014 Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24857694 2014 An enhancer polymorphism at the cardiomyocyte intercalated disc protein NOS1AP locus is a major regulator of the QT interval.
24665357 2014 NOS1AP modulates intracellular Ca(2+) in cardiac myocytes and is up-regulated in dystrophic cardiomyopathy.
24504561 2014 Association of common variants in NOS1AP gene with sudden unexplained nocturnal death syndrome in the southern Chinese Han population.
More...