Property Summary

NCBI Gene PubMed Count 34
Grant Count 5
R01 Count 4
Funding $315,876
PubMed Score 277.43
PubTator Score 1661.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (24)

PMID Text
25518740 Data indicate that plexin A1-4 (PLXNA1-4) mediation of neuroanatomical traits can be detected using in vivo neuroimaging techniques.
25335892 although plexin-A4 overexpression restored Sema3A signaling in plexin-A1-silenced cells, it failed to restore Sema3B signaling in plexin-A2-silenced cells.
23708657 PLXNA2 upregulation contributes to TMPRSS2:ERG-mediated enhancements of PC3c cell migration and invasion.
22912587 PLXNA2 has been identified as a new rare copy number variations gene for tetralogy of Fallot.
22095611 results of our study reveal that PlxnA2 has a pro-osteogenic function by modulating BMP2 signaling
22011406 PLXNA2 polymorphisms show association with ankylosing spondylitis.
21925246 in vitro analysis of PLXNA2 revealed that the gene has higher expression in more aggressive breast cancer cell types.
20633049 Observational study of gene-disease association. (HuGE Navigator)
20455246 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MEQRRPWPRALEVDSRSVVLLSVVWVLLAPPAAGMPQFSTFHSENRDWTFNHLTVHQGTGAVYVGAINRV      1 - 70
YKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSEVLTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLL     71 - 140
RLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESS    141 - 210
AMLDYELHSDFVSSLIKIPSDTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRI    211 - 280
VRLCKDDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKPGDSLAQAFNITSQDDVLFAIFSKGQKQYHHPP    281 - 350
DDSALCAFPIRAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSTPVE    351 - 420
GLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSI    421 - 490
DQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRRDKCQQAWEPNRFAASISQCV    491 - 560
SLAVHPSSISVSEHSRLLSLVVSDAPDLSAGIACAFGNLTEVEGQVSGSQVICISPGPKDVPVIPLDQDW    561 - 630
FGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISED    631 - 700
CPQLVPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYD    701 - 770
GMDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCTS    771 - 840
PSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLPGEYII    841 - 910
AEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLG    911 - 980
AGSSVAVYLGNQTCEFYGRSMSEIVCVSPPSSNGLGPVPVSVSVDRAHVDSNLQFEYIDDPRVQRIEPEW    981 - 1050
SIASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFG   1051 - 1120
FVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPC   1121 - 1190
AVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAGGSLLLIIVIIVLIAY   1191 - 1260
KRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIE   1261 - 1330
DHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEY   1331 - 1400
ATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQME   1401 - 1470
KGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNV   1471 - 1540
PYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPAS   1541 - 1610
ASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTR   1611 - 1680
LLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVN   1681 - 1750
VIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAK   1751 - 1820
LPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAM   1821 - 1890
SIES                                                                     1891 - 1894
//

Text Mined References (37)

PMID Year Title
25518740 2015 PlexinA polymorphisms mediate the developmental trajectory of human corpus callosum microstructure.
25335892 2014 The role of the plexin-A2 receptor in Sema3A and Sema3B signal transduction.
23708657 2014 Identification of novel TMPRSS2:ERG mechanisms in prostate cancer metastasis: involvement of MMP9 and PLXNA2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22912587 2012 Rare copy number variations in adults with tetralogy of Fallot implicate novel risk gene pathways.
22095611 2012 PlexinA2 mediates osteoblast differentiation via regulation of Runx2.
22011406 Identification of the semaphorin receptor plexin-A2 as a candidate gene for susceptibility to ankylosing spondylitis.
21925246 2011 Semaphorin-plexin signalling genes associated with human breast tumourigenesis.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
20633049 2010 Anxiety and depression in children and adults: influence of serotonergic and neurotrophic genes?
More...