Property Summary

NCBI Gene PubMed Count 26
PubMed Score 21.35
PubTator Score 25.36

Knowledge Summary

Patent

No data available

Synonym

Accession O75044 srGAP2
Symbols FNBP2
SRGAP3
SRGAP2A
ARHGAP34

Gene

PANTHER Protein Class (2)

PDB

2DL8   4RTT   4RUG  

Gene RIF (11)

PMID Text
23892896 interlocus gene conversions in SRGAP2
23782070 This study illustrated that the role of SRGAP2 protein and its human-specific paralogs in human brain development and evolution.
22559944 Results uncover a new function for ancestral SRGAP2 in promoting dendritic spine maturation and indicate that expression of a human-specific paralog of SRGAP2 in mouse pyramidal neurons extends the phase of spine development and leads to an increased density of longer spines in vivo, a feature characterizing pyramidal neurons in the human neocortex
22559943 SRGAP2 has been highly conserved over mammalian evolution, and human is the only lineage wherein gene duplications have occurred. Our analysis indicates that the duplications spread across 80 Mbp of chromosome 1 at a time corresponding to the transition from Australopithecus to Homo.
21148482 after Rac-dependent activation of FMNL1, srGAP2 mediates a potent mechanism to limit the duration of Rac action and inhibit formin activity during rapid actin dynamics.
20810653 srGAP2 arginine methylation plays important roles in cell spreading and cell migration through influencing membrane protrusion.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602751 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKL      1 - 70
AERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFK     71 - 140
KSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDST    141 - 210
ANVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCC    211 - 280
DLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMG    281 - 350
DMASQLCAQQPVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME    351 - 420
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLAR    421 - 490
RSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDS    491 - 560
IAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALHIRKVLLVLPKTTLIIMRYLFAFLNHLSQFS    561 - 630
EENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTIIIQHENIFPSPRELEGPVYSRGGSMEDYC    631 - 700
DSPHGETTPVEDSTQDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRH    701 - 770
NGIDGLIPHQYIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKR    771 - 840
PESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGSLNSISRHSSL    841 - 910
KNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQDIEATMNSALNELRELERQSSVKHTPDVVLDTLEPL    911 - 980
KTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATRPKPTVFPKTN    981 - 1050
ATSPGVNSSTSPQSTDKSCTV                                                    1051 - 1071
//

Text Mined References (33)

PMID Year Title
23892896 2013 Rapid and accurate large-scale genotyping of duplicated genes and discovery of interlocus gene conversions.
23782070 2013 The role of human-specific gene duplications during brain development and evolution.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23031429 2012 A genome-wide association study of monozygotic twin-pairs suggests a locus related to variability of serum high-density lipoprotein cholesterol.
22559944 2012 Inhibition of SRGAP2 function by its human-specific paralogs induces neoteny during spine maturation.
22559943 2012 Evolution of human-specific neural SRGAP2 genes by incomplete segmental duplication.
22467852 2012 The F-BAR domains from srGAP1, srGAP2 and srGAP3 regulate membrane deformation differently.
22106086 2012 Early infantile epileptic encephalopathy associated with the disrupted gene encoding Slit-Robo Rho GTPase activating protein 2 (SRGAP2).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...