Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.80
PubTator Score 7.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.600 0.000
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.700 0.000
inflammatory breast cancer -1.400 0.000
psoriasis -1.200 0.000

Synonym

Accession O75038 A2VCM3 B9DI80 Q3LUA8 Q86XJ2 Q86XU1 Q86YU7 Q8TEH5 Q8WUS6
Symbols PLCL4
PLC-L4
PLCeta2
PLC-eta2

Gene

 MGI Term (1)

Gene RIF (7)

PMID Text
21474938 PLCH2 might be a putative candidate gene for the neurodevelopmental delay observed in patients bearing 1p36.3 deletions.
20649401 The researchers investigated the D1S80 minisatellite and associated single nucelotide polymorphisms in a Tamil population in India.
18361507 Purified Gbeta 1gamma 2 stimulated the activity of purified PLC-eta2 in a concentration-dependent manner similar to that observed with purified PLC-beta2.
16107206 The molecular cloning and sequencing of phospholipase C eta2 are reported.
15899900 PLC(eta)2 is a neuron-specific isozyme that may be important for the formation and/or maintenance of the neuronal network in the postnatal brain
15583837 molecular cloning of PLC-eta1 and PLC-eta2
1979339 HIV-1 envelope glycoproteins gp120 and gp160 directly and specifically impair the CD3/TcR-mediated activation of phospholipase C (PLC) via the CD4 molecule in uninfected T cells

AA Sequence

MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPLVERCMGAMQEGMQMVKLRGGSKGLVRFYY      1 - 70
LDEHRSCIRWRPSRKNEKAKISIDSIQEVSEGRQSEVFQRYPDGSFDPNCCFSIYHGSHRESLDLVSTSS     71 - 140
EVARTWVTGLRYLMAGISDEDSLARRQRTRDQWLKQTFDEADKNGDGSLSIGEVLQLLHKLNVNLPRQRV    141 - 210
KQMFREADTDDHQGTLGFEEFCAFYKMMSTRRDLYLLMLTYSNHKDHLDAASLQRFLQVEQKMAGVTLES    211 - 280
CQDIIEQFEPCPENKSKGLLGIDGFTNYTRSPAGDIFNPEHHHVHQDMTQPLSHYFITSSHNTYLVGDQL    281 - 350
MSQSRVDMYAWVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPVILSIE    351 - 420
NHCSVIQQKKMAQYLTDILGDKLDLSSVSSEDATTLPSPQMLKGKILVKGKKLPANISEDAEEGEVSDED    421 - 490
SADEIDDDCKLLNGDASTNRKRVENTAKRKLDSLIKESKIRDCEDPNNFSVSTLSPSGKLGRKSKAEEDV    491 - 560
ESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSRALSDLV    561 - 630
KYTKSVATHDIEMEAASSWQVSSFSETKAHQILQQKPAQYLRFNQQQLSRIYPSSYRVDSSNYNPQPFWN    631 - 700
AGCQMVALNYQSEGRMLQLNRAKFSANGGCGYVLKPGCMCQGVFNPNSEDPLPGQLKKQLVLRIISGQQL    701 - 770
PKPRDSMLGDRGEIIDPFVEVEIIGLPVDCSREQTRVVDDNGFNPTWEETLVFMVHMPEIALVRFLVWDH    771 - 840
DPIGRDFIGQRTLAFSSMMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQALGLKGLFLRGPKPGSLDSH    841 - 910
AAGRPPARPSVSQRILRRTASAPTKSQKPGRRGFPELVLGTRDTGSKGVADDVVPPGPGPAPEAPAQEGP    911 - 980
GSGSPRDTRPLSTQRPLPPLCSLETIAEEPAPGPGPPPPAAVPTSSSQGRPPYPTGPGANVASPLEDTEE    981 - 1050
PRDSRPRPCNGEGAGGAYERAPGSQTDGRSQPRTLGHLPVIRRVKSEGQVPTEPLGGWRPLAAPFPAPAV   1051 - 1120
YSDATGSDPLWQRLEPCGHRDSVSSSSSMSSSDTVIDLSLPSLGLGRSRENLAGAHMGRLPPRPHSASAA   1121 - 1190
RPDLPPVTKSKSNPNLRATGQRPPIPDELQPRSLAPRMAGLPFRPPWGCLSLVGVQDCPVAAKSKSLGDL   1191 - 1260
TADDFAPSFEGGSRRLSHSLGLPGGTRRVSGPGVRRDTLTEQLRWLTVFQQAGDITSPTSLGPAGEGVAG   1261 - 1330
GPGFVRRSSSRSHSRVRAIASRARQAQERQQRLQGLGRQGPPEEERGTPEGACSVGHEGSVDAPAPSKGA   1331 - 1400
LGPASAAAENLVLLRL                                                         1401 - 1416
//

Text Mined References (14)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22197933 2011 A genome-wide association study in Chinese men identifies three risk loci for non-obstructive azoospermia.
21474938 2011 Role of phosphoinositide-specific phospholipase C ?2 in isolated and syndromic mental retardation.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20649401 2010 Investigating SNPs flanking the D1S80 locus in a Tamil population from India.
18361507 2008 Activation of human phospholipase C-eta2 by Gbetagamma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16107206 2005 Molecular cloning and characterization of PLC-eta2.
15899900 2005 A novel phospholipase C, PLC(eta)2, is a neuron-specific isozyme.
More...