Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.80
PubTator Score 7.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 2.23511063028431E-35
posterior fossa group A ependymoma 1511 1.92187772475872E-12
atypical teratoid / rhabdoid tumor 4369 8.13367699098191E-8
pilocytic astrocytoma 3086 1.28699294545725E-7
adult high grade glioma 2148 8.95707217082661E-7
glioblastoma 5572 1.55978951675583E-6
inflammatory breast cancer 404 1.10648494032521E-4
Disease Target Count Z-score Confidence
Azoospermia 89 0.0 2.0
Disease Target Count Z-score Confidence
Chromosome 1p36 deletion syndrome 24 5.103 2.6

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.600 0.000
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.700 0.000
inflammatory breast cancer -1.400 0.000
psoriasis -1.200 0.000

Synonym

Accession O75038 A2VCM3 B9DI80 Q3LUA8 Q86XJ2 Q86XU1 Q86YU7 Q8TEH5 Q8WUS6
Symbols PLCL4
PLC-L4
PLCeta2
PLC-eta2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

 MGI Term (1)

Gene RIF (7)

PMID Text
21474938 PLCH2 might be a putative candidate gene for the neurodevelopmental delay observed in patients bearing 1p36.3 deletions.
20649401 The researchers investigated the D1S80 minisatellite and associated single nucelotide polymorphisms in a Tamil population in India.
18361507 Purified Gbeta 1gamma 2 stimulated the activity of purified PLC-eta2 in a concentration-dependent manner similar to that observed with purified PLC-beta2.
16107206 The molecular cloning and sequencing of phospholipase C eta2 are reported.
15899900 PLC(eta)2 is a neuron-specific isozyme that may be important for the formation and/or maintenance of the neuronal network in the postnatal brain
15583837 molecular cloning of PLC-eta1 and PLC-eta2
1979339 HIV-1 envelope glycoproteins gp120 and gp160 directly and specifically impair the CD3/TcR-mediated activation of phospholipase C (PLC) via the CD4 molecule in uninfected T cells

AA Sequence

MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPLVERCMGAMQEGMQMVKLRGGSKGLVRFYY      1 - 70
LDEHRSCIRWRPSRKNEKAKISIDSIQEVSEGRQSEVFQRYPDGSFDPNCCFSIYHGSHRESLDLVSTSS     71 - 140
EVARTWVTGLRYLMAGISDEDSLARRQRTRDQWLKQTFDEADKNGDGSLSIGEVLQLLHKLNVNLPRQRV    141 - 210
KQMFREADTDDHQGTLGFEEFCAFYKMMSTRRDLYLLMLTYSNHKDHLDAASLQRFLQVEQKMAGVTLES    211 - 280
CQDIIEQFEPCPENKSKGLLGIDGFTNYTRSPAGDIFNPEHHHVHQDMTQPLSHYFITSSHNTYLVGDQL    281 - 350
MSQSRVDMYAWVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPVILSIE    351 - 420
NHCSVIQQKKMAQYLTDILGDKLDLSSVSSEDATTLPSPQMLKGKILVKGKKLPANISEDAEEGEVSDED    421 - 490
SADEIDDDCKLLNGDASTNRKRVENTAKRKLDSLIKESKIRDCEDPNNFSVSTLSPSGKLGRKSKAEEDV    491 - 560
ESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSRALSDLV    561 - 630
KYTKSVATHDIEMEAASSWQVSSFSETKAHQILQQKPAQYLRFNQQQLSRIYPSSYRVDSSNYNPQPFWN    631 - 700
AGCQMVALNYQSEGRMLQLNRAKFSANGGCGYVLKPGCMCQGVFNPNSEDPLPGQLKKQLVLRIISGQQL    701 - 770
PKPRDSMLGDRGEIIDPFVEVEIIGLPVDCSREQTRVVDDNGFNPTWEETLVFMVHMPEIALVRFLVWDH    771 - 840
DPIGRDFIGQRTLAFSSMMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQALGLKGLFLRGPKPGSLDSH    841 - 910
AAGRPPARPSVSQRILRRTASAPTKSQKPGRRGFPELVLGTRDTGSKGVADDVVPPGPGPAPEAPAQEGP    911 - 980
GSGSPRDTRPLSTQRPLPPLCSLETIAEEPAPGPGPPPPAAVPTSSSQGRPPYPTGPGANVASPLEDTEE    981 - 1050
PRDSRPRPCNGEGAGGAYERAPGSQTDGRSQPRTLGHLPVIRRVKSEGQVPTEPLGGWRPLAAPFPAPAV   1051 - 1120
YSDATGSDPLWQRLEPCGHRDSVSSSSSMSSSDTVIDLSLPSLGLGRSRENLAGAHMGRLPPRPHSASAA   1121 - 1190
RPDLPPVTKSKSNPNLRATGQRPPIPDELQPRSLAPRMAGLPFRPPWGCLSLVGVQDCPVAAKSKSLGDL   1191 - 1260
TADDFAPSFEGGSRRLSHSLGLPGGTRRVSGPGVRRDTLTEQLRWLTVFQQAGDITSPTSLGPAGEGVAG   1261 - 1330
GPGFVRRSSSRSHSRVRAIASRARQAQERQQRLQGLGRQGPPEEERGTPEGACSVGHEGSVDAPAPSKGA   1331 - 1400
LGPASAAAENLVLLRL                                                         1401 - 1416
//

Text Mined References (14)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22197933 2011 A genome-wide association study in Chinese men identifies three risk loci for non-obstructive azoospermia.
21474938 2011 Role of phosphoinositide-specific phospholipase C ?2 in isolated and syndromic mental retardation.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20649401 2010 Investigating SNPs flanking the D1S80 locus in a Tamil population from India.
18361507 2008 Activation of human phospholipase C-eta2 by Gbetagamma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16107206 2005 Molecular cloning and characterization of PLC-eta2.
15899900 2005 A novel phospholipase C, PLC(eta)2, is a neuron-specific isozyme.
More...