Property Summary

NCBI Gene PubMed Count 257
PubMed Score 1244.10
PubTator Score 449.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Waardenburg's syndrome 17 6.898 3.4
Disease Target Count Z-score Confidence
Microphthalmia 76 6.792 3.4
Osteopetrosis 43 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.608 2.4e-02
cystic fibrosis -1.200 3.2e-04
ductal carcinoma in situ -1.200 4.7e-03
fibroadenoma -1.900 5.7e-04
group 3 medulloblastoma -1.200 7.2e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.6e-02
invasive ductal carcinoma -1.400 5.4e-04
lung cancer -2.100 1.4e-05
lung carcinoma -1.900 1.3e-27
malignant mesothelioma -1.500 6.7e-06
medulloblastoma, large-cell -1.900 1.7e-05
non-small cell lung cancer -1.370 6.3e-18
osteosarcoma 1.212 3.2e-03
ovarian cancer -1.100 4.8e-05
Rheumatoid arthritis 1.100 1.6e-02
ulcerative colitis 1.200 2.1e-04

Protein-protein Interaction (5)

Gene RIF (215)

AA Sequence

MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQE      1 - 70
QERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQRQQVK     71 - 140
QYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECP    141 - 210
GMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNS    211 - 280
CPANLPNIKRELTACIFPTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNK    281 - 350
GTILKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR    351 - 420
IIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTL    421 - 490
SPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC                                      491 - 526
//

Text Mined References (267)

PMID Year Title