Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 2.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.102 0.000
colon cancer -1.200 0.001
fibroadenoma -1.900 0.018
ductal carcinoma in situ -1.800 0.003
invasive ductal carcinoma -1.900 0.009

Gene RIF (4)

PMID Text
26098415 LILRB5 binding to intracellular HLA-class I heavy chains suggests a chaperone function
25214527 The rs12975366 in the LILRB5 gene was significantly associated with CK levels of statin users.
20237496 Observational study of gene-disease association. (HuGE Navigator)
17998301 Mature cord-blood-derived mast cells expressed LILRB5 in cytoplasmic granules and upon cross-linking of the high-affinity IgE receptor, released LILRB5 into the culture medium.

AA Sequence

MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARK      1 - 70
RQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNV     71 - 140
TLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPS    141 - 210
DLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANF    211 - 280
TLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQI    281 - 350
DTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGP    351 - 420
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLRHRHQSKHRTS    421 - 490
AHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAPQDVTYAQLHSL    491 - 560
TLRREATEPPPSQEREPPAEPSIYAPLAIH                                            561 - 590
//

Text Mined References (12)

PMID Year Title
26098415 2015 The Leukocyte Immunoglobulin-Like Receptor Family Member LILRB5 Binds to HLA-Class I Heavy Chains.
25214527 2014 CKM and LILRB5 are associated with serum levels of creatine kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17998301 2008 Differential expression of leukocyte immunoglobulin-like receptors on cord-blood-derived human mast cell progenitors and mature mast cells.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...