Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.34
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.015
cutaneous lupus erythematosus 1.100 0.016
osteosarcoma -3.160 0.000
tuberculosis 2.400 0.000
lung cancer -1.500 0.000
lung carcinoma -1.500 0.000

Synonym

Accession O75019 O75018 Q3MJA6
Symbols LIR6
CD85I
LIR-6

Gene

Gene RIF (2)

PMID Text
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWI      1 - 70
TRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGN     71 - 140
VTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSL    141 - 210
PSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQA    211 - 280
NFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWG    281 - 350
PFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS    351 - 420
GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLFEAQHSQRSL     421 - 489
//

Text Mined References (19)

PMID Year Title
21559424 2011 LILRA3 binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1/LILRB2: structural evidence.
21547531 2012 Polymorphisms in ABLIM1 are associated with personality traits and alcohol dependence.
21388353 2011 Expression of activating and inhibitory leukocyte immunoglobulin-like receptors in rheumatoid synovium: correlations to disease activity.
21270408 2011 HLA class I allelic sequence and conformation regulate leukocyte Ig-like receptor binding.
20634939 2010 Modulation of Toll-like receptor activity by leukocyte Ig-like receptors and their effects during bacterial infection.
20595277 2010 Soluble LILRA3, a potential natural antiinflammatory protein, is increased in patients with rheumatoid arthritis and is tightly regulated by interleukin 10, tumor necrosis factor-alpha, and interferon-gamma.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19658091 2009 Alternative mRNA splicing creates transcripts encoding soluble proteins from most LILR genes.
18273033 2008 Association of LILRA2 (ILT1, LIR7) splice site polymorphism with systemic lupus erythematosus and microscopic polyangiitis.
More...