Property Summary

NCBI Gene PubMed Count 173
PubMed Score 1566.92
PubTator Score 207.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
periodontitis 269 8.79473422937614E-21
non-small cell lung cancer 2798 6.67438373107347E-15
ovarian cancer 8492 2.5310021843229E-8
nasopharyngeal carcinoma 1056 3.5693052916333E-7
lung adenocarcinoma 2714 2.4106773664083E-6
ulcerative colitis 2087 7.13025489030926E-6
lung cancer 4473 1.08969180882263E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.24706210065893E-4
pilocytic astrocytoma 3086 5.16692793930755E-4
medulloblastoma, large-cell 6234 0.00111956710035675
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00167331290911359
interstitial cystitis 2299 0.00174698584362461
dermatomyositis 967 0.00399459857131961
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00966858206405212
pancreatic cancer 2300 0.0120383932320172
active Crohn's disease 918 0.0197035273808227
osteosarcoma 7933 0.0367835833891038
cutaneous lupus erythematosus 1056 0.0466982995787682

Expression

  Differential Expression (20)

Synonym

Accession O75015
Symbols CD16
FCG3
CD16b
FCGR3
FCR-10
FCRIII
FCRIIIb

Gene

PANTHER Protein Class (1)

PDB

1E4K   1T83   1T89   1E4J   1FNL  

  Ortholog (1)

Species Source
Cow OMA Inparanoid

 GO Process (1)

 CSPA Cell Line (2)

Gene RIF (186)

PMID Text
27034964 data show that cross-linking FcgammaRIIIb is responsible for NET formation by the human neutrophil
26748351 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26407570 the results of this meta-analysis indicated that low FCGR3B CN increased susceptibility to autoimmune diseases--{REVIEW}
26314337 No relationship was found between the FCGR3B polymorphism and rheumatoid arthritis susceptibility.
26032265 Data show that gains or losses in copy numbers of Fc gamma receptors FCGR3A were less frequent than for FCGR3B and FCGR2C.
25966632 our method allows determining the CNV status of the FCGR locus, we identified association of CNV in FCGR3B to RA and showed a functional relationship between CNV in the FCGR3A gene and CD16A expression.
25816339 Results show that substitution of the serine 197 in the middle of the cleavage region for a proline (S197P) blocked CD16a and CD16b cleavage when expressed in NK cells but the mutation did not disrupt IgG binding by the receptors.
25626603 This study compared the FCGR3B gene frequencies among 230 unrelated healthy Eastern Thai blood donors in Rayong hospital with the previously published studies.
25428402 in the Indian population, FCGR3B gene copy number varied significantly when compared to other populations of the world.
25345863 Data show that the recombinant Fc gamma receptors FcgammaRIa, FcgammaRIIa, FcgammaRIIb, FcgammaRIIIa(Phe158/Val158), and FcgammaRIIIb glycosylation is complex and varied between receptors.
More...

AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQ      1 - 70
ASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVT     71 - 140
YLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVS    141 - 210
FCLVMVLLFAVDTGLYFSVKTNI                                                   211 - 233
//

Text Mined References (174)

PMID Year Title
27034964 2016 Differential Use of Human Neutrophil Fc? Receptors for Inducing Neutrophil Extracellular Trap Formation.
26748351 2016 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26407570 2015 Association between FCGR3B copy number variations and susceptibility to autoimmune diseases: a meta-analysis.
26314337 FCGR2A, FCGR3A, FCGR3B polymorphisms and susceptibility to rheumatoid arthritis: a meta-analysis.
26032265 2015 Allelic and copy-number variations of Fc?Rs affect granulocyte function and susceptibility for autoimmune blistering diseases.
25966632 2016 Association analysis of copy numbers of FC-gamma receptor genes for rheumatoid arthritis and other immune-mediated phenotypes.
25816339 2015 Identification of an ADAM17 cleavage region in human CD16 (Fc?RIII) and the engineering of a non-cleavable version of the receptor in NK cells.
25626603 2015 FCGR3B gene frequencies among ethnic Thai blood donors from a regional hospital in Eastern Thailand.
25428402 2015 Frequency distribution of autoimmunity associated FCGR3B gene copy number in Indian population.
25345863 2014 Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions.
More...