Property Summary

NCBI Gene PubMed Count 183
PubMed Score 1624.90
PubTator Score 207.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (20)

Disease log2 FC p
tuberculosis 1.800 3.7e-05
psoriasis 1.200 8.6e-04
active Crohn's disease 1.213 2.0e-02
Astrocytoma, Pilocytic 1.200 5.6e-04
cutaneous lupus erythematosus 1.700 4.7e-02
dermatomyositis 2.000 4.0e-03
interstitial cystitis 2.200 2.0e-02
intraductal papillary-mucinous adenoma (... -2.500 2.2e-04
intraductal papillary-mucinous carcinoma... -2.100 1.7e-03
intraductal papillary-mucinous neoplasm ... -2.100 9.7e-03
lung adenocarcinoma -1.371 2.4e-06
lung cancer -1.400 3.5e-04
medulloblastoma, large-cell -1.500 1.1e-03
nasopharyngeal carcinoma 1.400 3.6e-07
non-small cell lung cancer -1.711 6.7e-15
osteosarcoma -2.042 3.7e-02
ovarian cancer -2.900 2.5e-08
pancreatic cancer 1.100 1.2e-02
periodontitis 1.300 8.8e-21
ulcerative colitis 4.300 7.1e-06

 GO Function (1)

 CSPA Cell Line (2)

Protein-protein Interaction (12)

Gene RIF (196)

AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQ      1 - 70
ASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVT     71 - 140
YLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVS    141 - 210
FCLVMVLLFAVDTGLYFSVKTNI                                                   211 - 233
//

Text Mined References (184)

PMID Year Title