Property Summary

NCBI Gene PubMed Count 173
Grant Count 19
R01 Count 15
Funding $1,386,996.48
PubMed Score 1566.92
PubTator Score 207.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

 GO Process (1)

Gene RIF (186)

PMID Text
27034964 data show that cross-linking FcgammaRIIIb is responsible for NET formation by the human neutrophil
26748351 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26407570 the results of this meta-analysis indicated that low FCGR3B CN increased susceptibility to autoimmune diseases--{REVIEW}
26314337 No relationship was found between the FCGR3B polymorphism and rheumatoid arthritis susceptibility.
26032265 Data show that gains or losses in copy numbers of Fc gamma receptors FCGR3A were less frequent than for FCGR3B and FCGR2C.
25966632 our method allows determining the CNV status of the FCGR locus, we identified association of CNV in FCGR3B to RA and showed a functional relationship between CNV in the FCGR3A gene and CD16A expression.
25816339 Results show that substitution of the serine 197 in the middle of the cleavage region for a proline (S197P) blocked CD16a and CD16b cleavage when expressed in NK cells but the mutation did not disrupt IgG binding by the receptors.
25626603 This study compared the FCGR3B gene frequencies among 230 unrelated healthy Eastern Thai blood donors in Rayong hospital with the previously published studies.
25428402 in the Indian population, FCGR3B gene copy number varied significantly when compared to other populations of the world.
25345863 Data show that the recombinant Fc gamma receptors FcgammaRIa, FcgammaRIIa, FcgammaRIIb, FcgammaRIIIa(Phe158/Val158), and FcgammaRIIIb glycosylation is complex and varied between receptors.
More...

AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQ      1 - 70
ASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVT     71 - 140
YLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVS    141 - 210
FCLVMVLLFAVDTGLYFSVKTNI                                                   211 - 233
//

Text Mined References (174)

PMID Year Title
27034964 2016 Differential Use of Human Neutrophil Fc? Receptors for Inducing Neutrophil Extracellular Trap Formation.
26748351 2016 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26407570 2015 Association between FCGR3B copy number variations and susceptibility to autoimmune diseases: a meta-analysis.
26314337 FCGR2A, FCGR3A, FCGR3B polymorphisms and susceptibility to rheumatoid arthritis: a meta-analysis.
26032265 2015 Allelic and copy-number variations of Fc?Rs affect granulocyte function and susceptibility for autoimmune blistering diseases.
25966632 2016 Association analysis of copy numbers of FC-gamma receptor genes for rheumatoid arthritis and other immune-mediated phenotypes.
25816339 2015 Identification of an ADAM17 cleavage region in human CD16 (Fc?RIII) and the engineering of a non-cleavable version of the receptor in NK cells.
25626603 2015 FCGR3B gene frequencies among ethnic Thai blood donors from a regional hospital in Eastern Thailand.
25428402 2015 Frequency distribution of autoimmunity associated FCGR3B gene copy number in Indian population.
25345863 2014 Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions.
More...