Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVVSLPMPAGAAAANYTYWAYVPFPPLIRAVTWMDNPIEVYVNDSVWVPGPTDDH     71 - 140
CPAKPEEEGMMINISIGYRYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYHMVSGMSLRPRVNYLQ    141 - 210
DFSYQRSFKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAPRGQFYHNCSGQTQ    211 - 280
SCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGISTPRPKIISPVSGPEHPELWRLTVASHHIR    281 - 350
IWSGNQTLETRDRKPFYTVDLNSSVTVPLQSCIKPPYMLVVGNIVIKPDSQTITCENCRLLTCIDSTFNW    351 - 420
QHRILLVRAREGVWIPVSMDRPWETSPSIHTLTEVLKGVLNRSKRFIFTLIAVIMGLIAVTATAAVAGVA    421 - 490
LHSSVQSVNFVNDWQKNSTRLWNSQSSIDQKLANQINDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFSI    491 - 560
TPQIYNESEHHWDMVRRHLQGREDNLTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPVTWV    561 - 630
KTIGSTTIINLILILVCLFCLLLVCRCTQQLRRDSDHRERAMMTMAVLSKRKGGNVGKSKRDQIVTVSV     631 - 699
//

Text Mined References (9)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.
14557543 2003 Genomewide screening for fusogenic human endogenous retrovirus envelopes identifies syncytin 2, a gene conserved on primate evolution.
12970426 2003 Survey of human genes of retroviral origin: identification and transcriptome of the genes with coding capacity for complete envelope proteins.
12629516 2003 Quantitation of HERV-K env gene expression and splicing in human breast cancer.
10516026 1999 Genome-wide screening, cloning, chromosomal assignment, and expression of full-length human endogenous retrovirus type K.
9533039 1997 Chromosomal assignment of human endogenous retrovirus K (HERV-K) env open reading frames.
9460924 1998 Evolutionary relationships within a subgroup of HERV-K-related human endogenous retroviruses.
9060628 1997 Expression of human endogenous retrovirus type K envelope glycoprotein in insect and mammalian cells.