Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 4
Funding $502,195.75
PubMed Score 259.14
PubTator Score 63.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.057 0.032
astrocytic glioma 1.700 0.015
ependymoma 2.300 0.012
oligodendroglioma 1.900 0.011
psoriasis -2.000 0.000
osteosarcoma 1.850 0.000
medulloblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.100 0.000

Gene RIF (10)

PMID Text
25137142 These results identify a new domain of CE that is specific to its function in cytoplasmic capping, and a new role for Nck1 in regulating gene expression through its role as the scaffold for assembly of the cytoplasmic capping complex.
24330569 HIV-1 Tat interacts with mammalian capping enzyme (Mce1), stimulating its guanylyl-transferase and triphosphatase activities, thereby enhancing cap formation on TAR stem-loop RNA
23349942 Our biochemical studies provide the first insight that MZP can inhibit the formation of the RNA cap structure catalyzed by HCE.
21636784 Data show that human capping enzyme residues 229-567 comprise the minimum enzymatically active human GTase (hGTase) domain and determine the structure by X-ray crystallography.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14569024 HIV-1 Tat interacts with mammalian capping enzyme (Mce1), stimulating its guanylyl-transferase and triphosphatase activities, thereby enhancing cap formation on TAR stem-loop RNA
12408826 HIV-1 Tat interacts with mammalian capping enzyme (Mce1), stimulating its guanylyl-transferase and triphosphatase activities, thereby enhancing cap formation on TAR stem-loop RNA
12408826 HIV-1 Tat interacts with mammalian capping enzyme (Mce1), stimulating its guanylyl-transferase and triphosphatase activities, thereby enhancing cap formation on TAR stem-loop RNA
11278368 HIV-1 Tat interacts with mammalian capping enzyme (Mce1), stimulating its guanylyl-transferase and triphosphatase activities, thereby enhancing cap formation on TAR stem-loop RNA
11278368 HIV-1 Tat interacts with mammalian capping enzyme (Mce1), stimulating its guanylyl-transferase and triphosphatase activities, thereby enhancing cap formation on TAR stem-loop RNA

AA Sequence

MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNT      1 - 70
SRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAF     71 - 140
LVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDEDEDEDGKKES    141 - 210
EPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQN    211 - 280
IKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR    281 - 350
VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICT    351 - 420
SRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLY    421 - 490
VGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFE    491 - 560
FIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT                                     561 - 597
//

Text Mined References (22)

PMID Year Title
25137142 2014 The cytoplasmic capping complex assembles on adapter protein nck1 bound to the proline-rich C-terminus of Mammalian capping enzyme.
23349942 2013 The immunosuppressive agent mizoribine monophosphate is an inhibitor of the human RNA capping enzyme.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21636784 2011 Structure of the guanylyltransferase domain of human mRNA capping enzyme.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...