Property Summary

NCBI Gene PubMed Count 27
PubMed Score 12.77
PubTator Score 388.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.900 3.4e-05
Astrocytoma, Pilocytic -1.200 3.0e-05
atypical teratoid / rhabdoid tumor -1.400 1.1e-06
ependymoma -1.600 3.4e-13
glioblastoma -1.400 7.0e-07
lung cancer 1.300 3.9e-03
medulloblastoma -1.200 3.0e-04
medulloblastoma, large-cell -1.600 3.1e-05
osteosarcoma -1.102 5.1e-06
primitive neuroectodermal tumor -1.100 3.5e-03

Protein-protein Interaction (11)

Gene RIF (3)

AA Sequence

MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTL      1 - 70
DHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMC     71 - 140
GGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFL    141 - 210
DTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPH    211 - 280
SNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHM    281 - 350
SSGVPTPTKRLQYSQDIPSHLADEHALIASYVARLQHCARVLDSPSRLDEEHRLIARYAARLAAEAGNVT    351 - 420
RPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKD    421 - 490
ELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHC    491 - 560
PQDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVKELHSAEEGAEEEEEKMQNGKDRG       561 - 627
//

Text Mined References (34)

PMID Year Title