Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.13
PubTator Score 10.74

Knowledge Summary

Patent (1,912)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.000 7.0e-04
astrocytic glioma -1.900 3.9e-03
Astrocytoma, Pilocytic -1.800 1.1e-05
atypical teratoid / rhabdoid tumor -2.300 1.5e-08
Breast cancer -1.600 2.8e-52
ependymoma -2.500 3.5e-03
glioblastoma -2.000 5.7e-10
group 3 medulloblastoma -2.100 7.0e-03
lung adenocarcinoma -1.100 6.3e-08
medulloblastoma, large-cell -2.100 4.0e-03
oligodendroglioma -1.400 4.5e-02
Pick disease -1.300 1.1e-02
pituitary cancer 1.300 6.3e-03
primitive neuroectodermal tumor -2.700 4.2e-05
subependymal giant cell astrocytoma -2.641 1.6e-02

 CSPA Cell Line (1)

Gene RIF (10)

AA Sequence

MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQ      1 - 70
ECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHG     71 - 140
KIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNP    141 - 210
DDGAK                                                                     211 - 215
//

Text Mined References (23)

PMID Year Title