Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
Funding $208,525
PubMed Score 15.31
PubTator Score 10.74

Knowledge Summary

Patent (1,912)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.000 0.002
ependymoma -4.400 0.000
oligodendroglioma -2.200 0.016
glioblastoma -5.300 0.000
medulloblastoma -5.100 0.000
atypical teratoid / rhabdoid tumor -5.700 0.000
medulloblastoma, large-cell -5.600 0.000
primitive neuroectodermal tumor -5.200 0.000
pediatric high grade glioma -4.400 0.000
pilocytic astrocytoma -3.000 0.000
subependymal giant cell astrocytoma -2.641 0.016
lung adenocarcinoma -1.100 0.000
Breast cancer -2.600 0.000
Pick disease -1.500 0.034
pituitary cancer 2.600 0.000

Synonym

Accession O60939 O75302 Q9UNN3
Symbols ATFB14

Gene

PDB

5FDY   5FEB  

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model

Gene RIF (10)

PMID Text
26894959 The authors identified a flexible loop formed by (72)Cys and (75)Cys, a unique feature among the four beta-subunit isoforms.
26179811 Contribution of Cardiac Sodium Channel beta-Subunit Variants to Brugada Syndrome.
25757662 In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes.
24892658 With increased beta-2 expression, prostate cancer cells display a trend of enhanced association with nerve axons.
24337656 sodium channel polymorphisms are associated with epilepsy
23559163 SCN2B is a new candidate gene associated with Brugada syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20226894 Observational study of gene-disease association. (HuGE Navigator)
19808477 Observational study of gene-disease association. (HuGE Navigator)
15833746 beta2 is a PS/gamma-secretase substrate, gamma-secretase mediated cleavage of beta2-C-terminal fragment is required for cell-cell adhesion and migration of beta2-expressing cells

AA Sequence

MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQ      1 - 70
ECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHG     71 - 140
KIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNP    141 - 210
DDGAK                                                                     211 - 215
//

Text Mined References (23)

PMID Year Title
26894959 2016 Binary architecture of the Nav1.2-?2 signaling complex.
26179811 2015 Contribution of Cardiac Sodium Channel ?-Subunit Variants to Brugada Syndrome.
25757662 2015 The role of the sodium current complex in a nonreferred nationwide cohort of sudden infant death syndrome.
24892658 2014 Identification of beta-2 as a key cell adhesion molecule in PCa cell neurotropic behavior: a novel ex vivo and biophysical approach.
24337656 2014 Case-control association study of polymorphisms in the voltage-gated sodium channel genes SCN1A, SCN2A, SCN3A, SCN1B, and SCN2B and epilepsy.
23559163 2013 A missense mutation in the sodium channel ?2 subunit reveals SCN2B as a new candidate gene for Brugada syndrome.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
22992729 2012 Identification of the cysteine residue responsible for disulfide linkage of Na+ channel ? and ?2 subunits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20226894 2010 Sudden infant death syndrome-associated mutations in the sodium channel beta subunits.
More...