Property Summary

NCBI Gene PubMed Count 39
PubMed Score 197.59
PubTator Score 43.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 3.6e-02
atypical teratoid / rhabdoid tumor -1.500 3.1e-03
cutaneous lupus erythematosus -1.300 1.6e-02
ependymoma -1.100 2.8e-02
esophageal adenocarcinoma -1.300 1.8e-02
primary Sjogren syndrome -1.100 2.7e-02
subependymal giant cell astrocytoma 1.218 3.0e-02

Gene RIF (31)

AA Sequence

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE      1 - 70
AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE     71 - 140
GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS      141 - 208
//

Text Mined References (43)

PMID Year Title