Property Summary

NCBI Gene PubMed Count 367
Grant Count 369
R01 Count 310
Funding $40,165,055.88
PubMed Score 91.64
PubTator Score 1020.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.031 0.008
Multiple myeloma 1.028 0.020
psoriasis -1.500 0.001
autosomal dominant Emery-Dreifuss muscul... 1.050 0.004
lung cancer 1.300 0.034
non primary Sjogren syndrome sicca 1.100 0.022
gastric carcinoma 1.900 0.010
ulcerative colitis 1.200 0.000
ovarian cancer 2.300 0.000
pituitary cancer -1.200 0.000

Synonym

Accession O60934 B2R626 B2RNC5 O60672 Q32NF7 Q53FM6 Q63HR6 Q7LDM2
Symbols ATV
NBS
P95
NBS1
AT-V1
AT-V2

Gene

NBN

Gene RIF (349)

PMID Text
26869104 VRK1 regulation of NBS1 contributes to the stability of the repair complex and permits the sequential steps in DNA damage response.
26616756 Study shows that NBS1 may function in histone modification and in the coordination of chromatin remodeling to promote efficient and effective DNA double-strand break repair. [review]
26584681 NBS1 expression exhibited an association with epithelial ovarian cancers recurrence.
26544571 findings reveal a novel model for an intestinal bowel disease phenotype that occurs upon combined loss of the DNA repair cofactors ATMIN and NBS1
26514363 This study found a significant trend indicating that the risk increases as the number of adverse alleles increase and significant three-locus interaction model involving NBS1 rs1805794, MRE11 rs10831234, and ATM rs227062.
26493193 NBS1 E185Q allele carriers in renal cell carcinoma male patients had a lower 5-year survival rate.
26482424 kinetics of the accumulation of selected DNA repair-related proteins is protein specific at locally induced DNA lesions, and that the formation of gH2AX- and NBS1-positive foci, but not 53BP1-positive NBs, is cell cycle dependent in HeLa cells
26438602 These findings indicate the importance of the acetylation-dependent dynamic binding of NBS1 to damaged chromatin, created by histone H2AX exchange, for the proper accumulation of NBS1 at DNA damage sites.
26402912 genetic variants at NBN gene may contribute to gastric cancer susceptibility.
26308066 NBS1 has multifunctional roles in response to DNA damage from a variety of genotoxic agents, including IR
More...

AA Sequence

MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKD      1 - 70
NSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTV     71 - 140
NNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNV    141 - 210
DLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQT    211 - 280
LIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDE    281 - 350
KLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDAPTVKESCKTSSNNNSMVSNT    351 - 420
LAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLL    421 - 490
EQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIED    491 - 560
EVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDS    561 - 630
LWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLP    631 - 700
HIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR                    701 - 754
//

Text Mined References (379)

PMID Year Title
27568553 2016 MRNIP/C5orf45 Interacts with the MRN Complex and Contributes to the DNA Damage Response.
26869104 2016 VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage.
26616756 2016 Chromatin modification and NBS1: their relationship in DNA double-strand break repair.
26584681 2015 Clinicopathological values of NBS1 and DNA damage response genes in epithelial ovarian cancers.
26544571 2015 DNA Repair Cofactors ATMIN and NBS1 Are Required to Suppress T Cell Activation.
26514363 2016 Genetic variations in the homologous recombination repair pathway genes modify risk of glioma.
26493193 2015 DNA repair system and renal cell carcinoma prognosis: under the influence of NBS1.
26482424 2015 Distinct kinetics of DNA repair protein accumulation at DNA lesions and cell cycle-dependent formation of ?H2AX- and NBS1-positive repair foci.
26438602 2015 Acetylation of Histone H2AX at Lys 5 by the TIP60 Histone Acetyltransferase Complex Is Essential for the Dynamic Binding of NBS1 to Damaged Chromatin.
26402912 2015 Genetic Variation in the 3'-Untranslated Region of NBN Gene Is Associated with Gastric Cancer Risk in a Chinese Population.
More...