Property Summary

NCBI Gene PubMed Count 32
Grant Count 20
Funding $11,589,593.75
PubMed Score 9.78
PubTator Score 69.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma 1.603 0.000
lung cancer 2.100 0.001
ovarian cancer 1.600 0.002

Gene RIF (15)

PMID Text
26159921 found that the 3' fragments of target pre-mRNA generated by ASO were almost completely degraded from their 5' ends by nuclear XRN2 after RNase H1-mediated cleavage
26094573 Altered RNaseH1 has a reduced capability to remove the RNA from RNA-DNA hybrids leading to impaired mtDNA replication and adult-onset mitochondrial encephalomyopathy.
25330849 RNaseH1 maintains regulated levels of telomeric RNA-DNA hybrids at ALT telomeres to trigger homologous recombination without compromising telomere integrity too severely
23990920 RNase H1 and protein P32 are involved in mitochondrial pre-rRNA processing
23078533 data implicate the H264 side chain in phosphodiester hydrolysis as well as in product release, and are consistent with a proposed model in which the RNAse H1 H264 side chain interacts with a divalent metal ion to support catalysis
21443203 On the basis of its nuclear magnetic resonance (NMR) nucleic acid structure, a boranophosphonate-modified, fully R(P) BH(3) DNA/RNA hybrid is predicted not to be a substrate for RNase H1.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18337749 Characterization of full-length enzymes with defective hybrid binding domain indicates that this domain dramatically enhances both the specific activity and processivity of RNase H1.
17964265 Report crystal structures of RNase H1 in complex with RNA/DNA hybrids.
17028158 THE role substrate structure plays in directing human RNase H1 activity as well as the design of effective antisense oligodeoxyribonucleotides.
More...

AA Sequence

MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAF      1 - 70
VRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFV     71 - 140
VVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTD    141 - 210
SMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREG    211 - 280
AKQSED                                                                    281 - 286
//

Text Mined References (34)

PMID Year Title
26159921 2015 XRN2 is required for the degradation of target RNAs by RNase H1-dependent antisense oligonucleotides.
26094573 2015 RNASEH1 Mutations Impair mtDNA Replication and Cause Adult-Onset Mitochondrial Encephalomyopathy.
25330849 2014 RNaseH1 regulates TERRA-telomeric DNA hybrids and telomere maintenance in ALT tumour cells.
23990920 2013 Human RNase H1 is associated with protein P32 and is involved in mitochondrial pre-rRNA processing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23078533 2012 Evidence for a dual functional role of a conserved histidine in RNA·DNA heteroduplex cleavage by human RNase H1.
21700224 2011 Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.
21443203 2011 Structural basis of the RNase H1 activity on stereo regular borano phosphonate DNA/RNA hybrids.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...