Property Summary

Ligand Count 4
NCBI Gene PubMed Count 35
PubMed Score 14.14
PubTator Score 69.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 2.100 6.1e-04
osteosarcoma 1.603 7.8e-05
ovarian cancer -1.400 3.4e-06
psoriasis 1.400 1.5e-04

Gene RIF (18)

AA Sequence

MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAF      1 - 70
VRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFV     71 - 140
VVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTD    141 - 210
SMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREG    211 - 280
AKQSED                                                                    281 - 286
//

Text Mined References (37)

PMID Year Title