Property Summary

NCBI Gene PubMed Count 26
PubMed Score 58.49
PubTator Score 33.38

Knowledge Summary

Patent (2,662)

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.900 2.5e-03
gastric carcinoma -1.300 8.6e-03
lung cancer 1.400 7.7e-03
psoriasis -1.700 8.3e-03

Gene RIF (14)

AA Sequence

MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVFSASFVVHWLV      1 - 70
FAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTIGYGTMFPSGDCPSAIALLAI     71 - 140
QMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAHMDGKPNLIFQVANTRPSPLTSVRVSAVLYQ    141 - 210
ERENGKLYQTSVDFHLDGISSDECPFFIFPLTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGE    211 - 280
ICQRRTSYLPSEIMLHHCFASLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDN    281 - 350
FQISETGLTE                                                                351 - 360
//

Text Mined References (27)

PMID Year Title