Property Summary

NCBI Gene PubMed Count 24
Grant Count 1
Funding $187,500
PubMed Score 11.22
PubTator Score 17.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.131 0.000
non primary Sjogren syndrome sicca 1.200 0.018
acute myeloid leukemia 1.100 0.017
ovarian cancer 1.400 0.001

Synonym

Accession O60927
Symbols HCGV
IPP3
HCG-V
TCTE5
TCTEX5
CFAP255

Gene

 Grant Application (1)

Gene RIF (5)

PMID Text
25298395 a model in which I3 regulates an SDS22-mediated PP1 activation step in solution that precedes SDS22 dissociation and transfer of PP1 to kinetochores, and which is required for PP1 to efficiently antagonize Aurora B.
19851445 Observational study of gene-disease association. (HuGE Navigator)
18951879 Inh3 has two domains that are required for its interaction with PP1.
18450750 inhibitor-3 is an in vivo target of caspase-3 and participates in the apoptotic response
17630778 Sds22 and Inhibitor-3 form a heterotrimeric complex with PP1, both in cell lysates and after purification. A pool of PP1 is complexly controlled by both Sds22 and Inhibitor-3.

AA Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF      1 - 70
GESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH                   71 - 126
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25298395 2014 Inhibitor-3 ensures bipolar mitotic spindle attachment by limiting association of SDS22 with kinetochore-bound protein phosphatase-1.
24489884 2014 Genome-wide association study of proneness to anger.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
More...