Property Summary

NCBI Gene PubMed Count 27
PubMed Score 11.48
PubTator Score 17.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.9e-04
ovarian cancer 8520 7.0e-04
acute myeloid leukemia 783 1.7e-02
non primary Sjogren syndrome sicca 891 1.8e-02
Disease Target Count Z-score Confidence
McCune Albright syndrome 19 3.308 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.100 1.7e-02
non primary Sjogren syndrome sicca 1.200 1.8e-02
osteosarcoma 1.131 1.9e-04
ovarian cancer 1.400 7.0e-04

Synonym

Accession O60927
Symbols HCGV
IPP3
HCG-V
TCTE5
TCTEX5
CFAP255

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (6)

AA Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF      1 - 70
GESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH                   71 - 126
//

Text Mined References (31)

PMID Year Title