Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.07
PubTator Score 5.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.8e-02
Disease Target Count Z-score Confidence
Pelizaeus-Merzbacher disease 19 3.09 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.8e-02

Synonym

Accession O60925 B2RD02 Q53F95 Q96EX6
Symbols PDF
PFD1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL      1 - 70
QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ                       71 - 122
//

Text Mined References (26)

PMID Year Title