Property Summary

NCBI Gene PubMed Count 29
Grant Count 194
R01 Count 17
Funding $95,487,645.98
PubMed Score 43.21
PubTator Score 38.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.400 0.000
osteosarcoma 1.375 0.008
atypical teratoid / rhabdoid tumor 2.800 0.000
Atopic dermatitis -2.600 0.000
non-small cell lung cancer 2.021 0.000
intraductal papillary-mucinous neoplasm ... 2.600 0.003
lung cancer 2.100 0.000
lung adenocarcinoma 1.400 0.001
spina bifida -1.285 0.048
ulcerative colitis -1.100 0.001
Breast cancer 1.500 0.001
pituitary cancer 2.000 0.001

Synonym

Accession O60911 O60233 Q2TB86 Q5T1U0
Symbols CTSU
CATL2
CTSL2

Gene

PANTHER Protein Class (3)

PDB

3KFQ   1FH0   3H6S  

Gene RIF (21)

PMID Text
24719048 Co-stimulation with pro-atherogenic shear stress and HIV-1 Tat upregulates cathepsin K and V activity in human aortic endothelial cells
24121514 using cathepsin V and cathepsin L as model enzymes, a series of chimeras were generated to identify noncatalytic regions that are responsible for the potent elastolytic activity of cathepsin V
23871919 Expression of cathepsins K, S and V within keratinocytes is reduced in photoprotected skin of aged women.
23542171 E2F1 directly binds to CTSL2 promoter and regulates CTSL2 gene expression.
23287360 Cathepsin V expression contributes to the development of dermal fibrosis and vasculopathy in systemic sclerosis.
22967898 functions of cathepsin V are controlled by N-glycosylation
22562303 inflammatory cues and monocyte-endothelial cell interactions upregulate cathepsin K and V activity via a JNK signaling axis
22452389 CTSL2 might be involved in progression of endometrial cancer.
22393040 Findings indicate the unique function of cathepsin V for producing enkephalin and neuropeptide Y (NPY) neuropeptides required for neurotransmission in health and neurological diseases.
20536394 A proteolytically active variant of cathepsin V is localized to cell nucleus (in peri-nucleolar pattern) in thyroid carcinoma cells.
More...

AA Sequence

MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGK      1 - 70
HGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWA     71 - 140
FSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEI    141 - 210
CKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVL    211 - 280
VVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV                    281 - 334
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24121514 2013 Elastin degradation by cathepsin V requires two exosites.
23871919 2014 Differential expression of cathepsins K, S and V between young and aged Caucasian women skin epidermis.
23542171 2014 CTSL2 is a pro-apoptotic target of E2F1 and a modulator of histone deacetylase inhibitor and DNA damage-induced apoptosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23287360 2013 Decreased cathepsin V expression due to Fli1 deficiency contributes to the development of dermal fibrosis and proliferative vasculopathy in systemic sclerosis.
22967898 2012 Determination of cathepsin V activity and intracellular trafficking by N-glycosylation.
22562303 2012 Tumor necrosis factor alpha stimulates cathepsin K and V activity via juxtacrine monocyte-endothelial cell signaling and JNK activation.
22452389 2012 Expression of cysteine protease cathepsin L is increased in endometrial cancer and correlates with expression of growth regulatory genes.
22393040 2012 Human cathepsin V protease participates in production of enkephalin and NPY neuropeptide neurotransmitters.
More...