Property Summary

Ligand Count 65
NCBI Gene PubMed Count 31
PubMed Score 46.26
PubTator Score 38.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis -2.600 1.2e-05
atypical teratoid / rhabdoid tumor 2.800 4.8e-04
Breast cancer 1.500 6.3e-04
intraductal papillary-mucinous neoplasm ... 2.600 3.0e-03
lung adenocarcinoma 1.400 1.5e-03
lung cancer 2.100 1.2e-04
malignant mesothelioma 1.100 1.4e-04
non-small cell lung cancer 2.021 3.5e-17
osteosarcoma 1.375 8.0e-03
pituitary cancer 2.000 1.5e-03
psoriasis -1.100 8.8e-03
spina bifida -1.285 4.8e-02
ulcerative colitis -1.100 5.2e-04

Protein-protein Interaction (2)

Gene RIF (23)

AA Sequence

MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGK      1 - 70
HGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWA     71 - 140
FSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEI    141 - 210
CKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVL    211 - 280
VVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV                    281 - 334
//

Text Mined References (33)

PMID Year Title