Property Summary

NCBI Gene PubMed Count 22
PubMed Score 35.81
PubTator Score 131.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.300 1.1e-02
astrocytoma 1.200 3.2e-03
atypical teratoid / rhabdoid tumor 1.600 2.0e-03
gastric cancer -1.100 3.2e-02
glioblastoma 2.000 5.9e-04
group 3 medulloblastoma -1.100 3.5e-02
interstitial cystitis -1.100 6.8e-05
lung cancer 1.200 6.5e-04
medulloblastoma, large-cell 1.300 7.8e-05
Multiple myeloma 1.168 3.6e-02
osteosarcoma 1.019 8.3e-06
ovarian cancer -1.600 1.9e-03
Pick disease 2.100 4.5e-05
psoriasis -2.200 1.7e-04
Rheumatoid arthritis 3.000 6.0e-05

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVNFLVYRYLQES      1 - 70
GFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMP     71 - 140
DVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEENRAHSVNNHAK    141 - 210
PMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIRE    211 - 280
GGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVD    281 - 350
KTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKW    351 - 420
DPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLW    421 - 490
DIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDK    491 - 560
VGASASDGSVCVLDLRK                                                         561 - 577
//

Text Mined References (24)

PMID Year Title