Property Summary

NCBI Gene PubMed Count 20
Grant Count 24
R01 Count 15
Funding $2,261,787.46
PubMed Score 34.57
PubTator Score 131.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 3.000 0.000
gastric cancer -1.100 0.032
Multiple myeloma 1.168 0.036
psoriasis -2.200 0.000
osteosarcoma 1.936 0.000
astrocytoma 2.200 0.001
atypical teratoid / rhabdoid tumor 2.300 0.000
glioblastoma 2.000 0.001
medulloblastoma, large-cell 1.300 0.000
lung cancer 1.200 0.001
interstitial cystitis -1.100 0.000
pediatric high grade glioma 1.300 0.002
group 4 medulloblastoma -1.600 0.009
Pick disease 2.100 0.000
ovarian cancer -1.600 0.002

Gene RIF (7)

PMID Text
26070712 Here, the authors show that transcriptional co-factor Transducin beta-like (TBL) 1 was over-expressed in both human and murine pancreatic ductal adenocarcinoma and TBL1 deficiency both prevented and reversed pancreatic tumor growth.
26070566 TBL1 is required to protect GPS2 from degradation, with methylation of GPS2 by arginine methyltransferase PRMT6 regulating the interaction with TBL1 and inhibiting proteasome-dependent degradation.
23665419 We localized proteins encoded by the top two regulated genes, TBL1X and USH1C, using immunohistochemistry to placental stem and anchoring villi associated with active contractile function.
18976975 Knockdown of transducin (beta)-like 1X-linked (TBL1X) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18193033 Wnt signalling induced the interaction between beta-catenin and TBL1-TBLR1, as well as their binding to Wnt target genes. Importantly, the recruitment of TBL1-TBLR1 and beta-catenin to Wnt target-gene promoters was mutually dependent on each other.
16258276 Mutations within the LisH (LIS1 homology)motif of TBL 1X are likely to result in pathogenic consequences in genes associated with genetic diseases.
15601853 TBL1 and TBLR1 are functionally redundant and essential for transcriptional repression by unliganded thyroid hormone receptors (TR) but not essential for transcriptional activation by liganded TR

AA Sequence

MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVNFLVYRYLQES      1 - 70
GFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMP     71 - 140
DVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEENRAHSVNNHAK    141 - 210
PMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIRE    211 - 280
GGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVD    281 - 350
KTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKW    351 - 420
DPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLW    421 - 490
DIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDK    491 - 560
VGASASDGSVCVLDLRK                                                         561 - 577
//

Text Mined References (22)

PMID Year Title
26070712 2015 Transcriptional co-factor Transducin beta-like (TBL) 1 acts as a checkpoint in pancreatic cancer malignancy.
26070566 2015 Exchange Factor TBL1 and Arginine Methyltransferase PRMT6 Cooperate in Protecting G Protein Pathway Suppressor 2 (GPS2) from Proteasomal Degradation.
23665419 Prenatal smoke exposure: effects on infant auditory system and placental gene expression.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
18374649 2008 TBL1 and TBLR1 phosphorylation on regulated gene promoters overcomes dual CtBP and NCoR/SMRT transcriptional repression checkpoints.
18326024 2008 Histone deacetylase 3 localizes to the mitotic spindle and is required for kinetochore-microtubule attachment.
18193033 2008 TBL1-TBLR1 and beta-catenin recruit each other to Wnt target-gene promoter for transcription activation and oncogenesis.
16258276 2005 Novel functional features of the Lis-H domain: role in protein dimerization, half-life and cellular localization.
15772651 2005 The DNA sequence of the human X chromosome.
More...