Property Summary

NCBI Gene PubMed Count 32
Grant Count 103
R01 Count 68
Funding $8,127,759.4
PubMed Score 185.21
PubTator Score 91.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis 1.700 0.002
posterior fossa group B ependymoma 1.400 0.000

Synonym

Accession O60906 Q5TED1 Q9BWR3
Symbols ISC1
NSMASE
NSMASE1

Gene

 MGI Term (1)

Gene RIF (22)

PMID Text
25224994 Interestingly, neutral but not acid sphingomyelinase was mandatory for PorBIA -mediated Neisseria gonorrhoeae invasion into host cells.
25168245 nSMase1 (sphingomyelin phosphodiesterase 2, SMPD2)has a common central role in ceramide signaling during the stress and cytokine responses and apoptosis.
24358176 These data suggest that Ox-LDL activates N-SMase-ceramide signaling pathway, and stimulates phosphorylation of p38 MAPK, leading to apoptosis in vascular smooth muscle cells, which initiates VSMC calcification.
22899568 NSM2 plays a key role in the cellular response to hyperosmolar stress, and its activity regulates both cytokine secretion and lipid droplet formation.
22721673 HIV-1 Nef inhibits sphingomyelinase activity in human podocyte
21335555 cells deficient in acid ceramidase (aCDase) also exhibited defects in CCL5 induction, whereas cells deficient in sphingosine kinase-1 and -2 exhibited higher levels of CCL5.
20836852 Results demonstrate that WithaD enhance the ceramide accumulation by activating N-SMase 2, modulate phosphorylation of the JNK and p38MAPK and induced apoptosis in both myeloid and lymphoid cells along with primary cells derived from leukemia patients.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20448054 nSMase2 has a role in ceramide generation, aberrant apoptosis, and lung injury under cigarette smoke exposure
20378749 N-SMase at the cytofacial plasma membrane is an essential element for the proper orientation of PMNs in FMLP gradients, at least in part by polarizing the distribution of Rac 1/2 and RhoA GTPases.
More...

AA Sequence

MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLRQKLSPTYPAA      1 - 70
HHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGLLVLHLSGMVLNAYVTHLHAE     71 - 140
YNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGS    141 - 210
EEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLF    211 - 280
VRHSPPQQNPSSTHGPAERSPLMCVLKEAWTELGLGMAQARWWATFASYVIGLGLLLLALLCVLAAGGGA    281 - 350
GEAAILLWTPSVGLVLWAGAFYLFHVQEVNGLYRAQAELQHVLGRAREAQDLGPEPQPALLLGQQEGDRT    351 - 420
KEQ                                                                       421 - 423
//

Text Mined References (33)

PMID Year Title
25224994 2015 Neutral sphingomyelinase 2 is a key factor for PorB-dependent invasion of Neisseria gonorrhoeae.
25168245 2015 Stress-induced ceramide generation and apoptosis via the phosphorylation and activation of nSMase1 by JNK signaling.
24358176 2013 Ceramide mediates Ox-LDL-induced human vascular smooth muscle cell calcification via p38 mitogen-activated protein kinase signaling.
22899568 2012 Hyperosmolarity-induced lipid droplet formation depends on ceramide production by neutral sphingomyelinase 2.
21335555 2011 Regulation of CC ligand 5/RANTES by acid sphingomyelinase and acid ceramidase.
20836852 2010 Withanolide D induces apoptosis in leukemia by targeting the activation of neutral sphingomyelinase-ceramide cascade mediated by synergistic activation of c-Jun N-terminal kinase and p38 mitogen-activated protein kinase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20448054 2011 Neutral sphingomyelinase 2: a novel target in cigarette smoke-induced apoptosis and lung injury.
20378749 2011 An obligate role for membrane-associated neutral sphingomyelinase activity in orienting chemotactic migration of human neutrophils.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...