Property Summary

Ligand Count 2
NCBI Gene PubMed Count 32
PubMed Score 192.83
PubTator Score 91.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.8e-08
malignant mesothelioma 3232 1.8e-05
psoriasis 6694 2.4e-03
Disease Target Count Z-score Confidence
Niemann-Pick disease 14 4.024 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.100 4.8e-08
malignant mesothelioma -1.100 1.8e-05
psoriasis 1.700 2.4e-03

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (21)

AA Sequence

MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLRQKLSPTYPAA      1 - 70
HHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGLLVLHLSGMVLNAYVTHLHAE     71 - 140
YNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGS    141 - 210
EEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLF    211 - 280
VRHSPPQQNPSSTHGPAERSPLMCVLKEAWTELGLGMAQARWWATFASYVIGLGLLLLALLCVLAAGGGA    281 - 350
GEAAILLWTPSVGLVLWAGAFYLFHVQEVNGLYRAQAELQHVLGRAREAQDLGPEPQPALLLGQQEGDRT    351 - 420
KEQ                                                                       421 - 423
//

Text Mined References (33)

PMID Year Title