Property Summary

NCBI Gene PubMed Count 27
Grant Count 17
R01 Count 17
Funding $1,752,874.64
PubMed Score 43.09
PubTator Score 46.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 7.100 0.000
psoriasis -2.900 0.000
glioblastoma 2.700 0.002
osteosarcoma 3.556 0.000
medulloblastoma 3.400 0.017
cystic fibrosis -1.399 0.000
atypical teratoid / rhabdoid tumor 2.200 0.007
medulloblastoma, large-cell 5.300 0.000
primitive neuroectodermal tumor 3.200 0.038
non-small cell lung cancer 1.058 0.000
lung cancer 3.700 0.000
adult high grade glioma 3.200 0.005
primary Sjogren syndrome 1.100 0.000
invasive ductal carcinoma -1.300 0.008
ovarian cancer -1.900 0.000

 GO Component (1)

Gene RIF (17)

PMID Text
25675432 The longitudinal measurement of extracellular plasma mSHOX2 DNA yields information about the response to cytotoxic treatment and allows an early assessment of treatment response for lung cancer patients.
25533636 SHOX2 overexpression favors differentiation of embryonic stem cells into cardiac pacemaker cells, improving biological pacing ability.
25331797 SHOX2 DNA methylation identified 66% of the patients with cancer subsequent to a cytological equivocal diagnosis. SHOX2 complements the cytological diagnosis and the methylation marker panel.
24746361 miR-375/SHOX2 functional relationship regulates breast tumorigenesis by controlling the process of EMT.
24421874 SHOX2, like SHOX, regulates NPPB directly whilst activates ACAN via its cooperation with the SOX trio.
24386354 prognostic value of SHOX2 and SEPT9 DNA methylation in benign, paramalignant and malignant pleural effusions
24136974 The assay is based on quantification of methylated Short Stature Homeobox gene two (SHOX2) DNA in the specimen measured via multiplex real-time Polymerase Chain Reaction (PCR) on bisulfite-converted DNA.
24026539 The combination of EBUS-TBNA and SHOX2 methylation level strongly improves the assessment of the nodal status by identifying additional malignant lesions and confirming benign nodes and therefore avoiding invasive follow-up procedures.
23851611 Elevated SHOX2 expression is associated with tumor recurrence of hepatocellular carcinoma.
23038774 Shox2 regulates progression through chondrogenesis at two distinct stages--the onset of early differentiation and the transition to maturation and hypertrophy.
More...

AA Sequence

MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDRSSPAVRAAGGGGGGGGGGG      1 - 70
GGGGGGGVGGGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQ     71 - 140
RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGA    141 - 210
ASQFEACRVAPYVNVGALRMPFQQDSHCNVTPLSFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAP    211 - 280
PFGLPLATLAADSASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL                       281 - 331
//

Text Mined References (27)

PMID Year Title
25675432 2015 Quantification of cell-free mSHOX2 Plasma DNA for therapy monitoring in advanced stage non-small cell (NSCLC) and small-cell lung cancer (SCLC) patients.
25533636 2015 SHOX2 overexpression favors differentiation of embryonic stem cells into cardiac pacemaker cells, improving biological pacing ability.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25331797 Analysis of SHOX2 methylation as an aid to cytology in lung cancer diagnosis.
24746361 2014 SHOX2 is a direct miR-375 target and a novel epithelial-to-mesenchymal transition inducer in breast cancer cells.
24421874 2014 NPPB and ACAN, two novel SHOX2 transcription targets implicated in skeletal development.
24386354 2013 Diagnostic and prognostic value of SHOX2 and SEPT9 DNA methylation and cytology in benign, paramalignant and malignant pleural effusions.
24136974 SHOX2 DNA methylation is a tumour marker in pleural effusions.
24026539 2013 Assessment of SHOX2 methylation in EBUS-TBNA specimen improves accuracy in lung cancer staging.
23851611 2013 Elevated SHOX2 expression is associated with tumor recurrence of hepatocellular carcinoma.
More...