Property Summary

NCBI Gene PubMed Count 35
PubMed Score 48.05
PubTator Score 46.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
lung cancer 1.200 1.6e-02
adult high grade glioma 1.300 3.5e-02
atypical teratoid / rhabdoid tumor 2.200 6.9e-03
cystic fibrosis -1.399 5.7e-05
glioblastoma 2.200 8.9e-03
invasive ductal carcinoma -1.300 7.9e-03
malignant mesothelioma 1.900 7.9e-07
medulloblastoma 2.600 2.1e-02
medulloblastoma, large-cell 3.600 2.3e-03
non-small cell lung cancer 1.058 4.8e-08
osteosarcoma 3.556 1.2e-04
ovarian cancer -1.900 4.8e-05
primary Sjogren syndrome 1.100 2.7e-04
primitive neuroectodermal tumor 3.200 3.8e-02
psoriasis -1.300 1.6e-06

Synonym

Accession O60902 O60465 O60467 O60903
Symbols OG12
SHOT
OG12X

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

Gene RIF (25)

AA Sequence

MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDRSSPAVRAAGGGGGGGGGGG      1 - 70
GGGGGGGVGGGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQ     71 - 140
RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGA    141 - 210
ASQFEACRVAPYVNVGALRMPFQQDSHCNVTPLSFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAP    211 - 280
PFGLPLATLAADSASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL                       281 - 331
//

Text Mined References (35)

PMID Year Title