Property Summary

NCBI Gene PubMed Count 46
Grant Count 22
R01 Count 11
Funding $604,387.2
PubMed Score 44.43
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
24831942 the AM system is widely expressed in human thymus from newborns; both AM1 receptor components CLR and RAMP2, but not RAMP3, are not associated with the plasma membrane of TECs and thymocytes but are located intracellularly, notably in the nucleus
24199627 Data suggest isoforms of RAMP modulate accessibility of peptides to residues situated on CALCRL (calcitonin receptor-like receptor) N-terminal domain; RAMP3/RAMP2/RAMP1 appear to alter accessibility of specific residues at CALCRL-RAMP interface.
24169318 The expression of RAMP3 is downregulated in the fetal lung with increasing gestational age.
22445753 the RAMP3 TMD participates in the negative regulation of CLR/RAMP3 internalization.
20802105 Data show that LOXL2 and RAMP3 are strongly coexpressed in human colon, breast, and gastric carcinomas but not in normal colon or gastric epithelial cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20034525 This study provides insight into the role of three amino acid changes in human RAMP3.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19886671 Morphological fluorescence techniques, bioluminescence resonance energy transfer, and bimolecular fluorescence complementation analysis demonstrate that the secretin receptor associates specifically with RAMP3, but not with RAMP1 or RAMP2.
18835256 The His residues of hRAMP2 and -3 differentially govern adrenomedullin receptor function.
More...

AA Sequence

METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFT      1 - 70
NCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWR     71 - 140
SKRTDTLL                                                                  141 - 148
//

Text Mined References (46)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24831942 2014 Expression and distribution of the adrenomedullin system in newborn human thymus.
24199627 2014 Receptor activity-modifying protein-dependent effects of mutations in the calcitonin receptor-like receptor: implications for adrenomedullin and calcitonin gene-related peptide pharmacology.
24169318 2014 Adrenomedullin expression in the developing human fetal lung.
23674134 2013 G-protein-coupled receptor 30 interacts with receptor activity-modifying protein 3 and confers sex-dependent cardioprotection.
22445753 2012 Characterization of the single transmembrane domain of human receptor activity-modifying protein 3 in adrenomedullin receptor internalization.
20802105 2011 Receptor activity modifying protein-3 mediates the protumorigenic activity of lysyl oxidase-like protein-2.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20034525 2010 Functional characterization of two human receptor activity-modifying protein 3 variants.
More...