Property Summary

Ligand Count 1
NCBI Gene PubMed Count 47
PubMed Score 81.46
PubTator Score 45.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.700 4.4e-05
group 4 medulloblastoma 1.700 8.1e-04
invasive ductal carcinoma -1.300 3.3e-03
lung adenocarcinoma -1.600 1.6e-17
lung cancer -2.400 9.4e-04
lung carcinoma -1.700 7.6e-09
medulloblastoma, large-cell 2.000 2.0e-05
nephrosclerosis 1.040 1.1e-03
non-small cell lung cancer -1.962 4.8e-29
primitive neuroectodermal tumor 1.800 4.9e-05
psoriasis -1.300 1.4e-03

Gene RIF (25)

AA Sequence

MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWN      1 - 70
HYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSD     71 - 140
PPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA                                       141 - 175
//

Text Mined References (48)

PMID Year Title