Property Summary

NCBI Gene PubMed Count 52
Grant Count 48
R01 Count 33
Funding $2,594,670.13
PubMed Score 142.66
PubTator Score 78.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (33)

PMID Text
26501962 Evidence that DNA methylation at RAMP1 gene promoter plays a role in migraine was described.
25982113 Data suggest that ligand binding of a G protein-coupled receptor (GPCR) may inform drug development targeting calcitonin receptor-like receptor (CLR):receptor activity-modifying proteins RAMP1/2 complexes.
25881990 RAMP1 rs7590387 has a role in the transformation of episodic migraine into medication overuse headache.
24454825 A novel functional role for RAMP1 in regulation of CaSR signalling in addition to its known role in receptor trafficking, is reported.
23867798 multiple NKX3.1 binding sites were found in the RAMP1 locus in human prostate cancer cells and in the normal mouse prostate.
23237777 No significant association of the tested SNPs of the RAMP1 gene were found with migraine susceptibility.
22949393 RAMP1 overexpression enhances the promoting effect that exogenous CGRP has on osteogenic differentiation
22484227 CLR and RAMP1 co-localize in the enteric nervous system of human stomach, ileum, and colon, and are in close proximity to their ligands CGRP and IMD
22208649 The present finding demonstrated that RAMP1 immunoreactivity was localized in many neurons and phenopalatine ganglion.
20933260 lower expression in bronchial biopsies from subjects with asthma
More...

AA Sequence

MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELA      1 - 70
DCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQ     71 - 140
SKRTEGIV                                                                  141 - 148
//

Text Mined References (53)

PMID Year Title
26501962 2015 DNA methylation of RAMP1 gene in migraine: an exploratory analysis.
25982113 2015 Structural Basis for Receptor Activity-Modifying Protein-Dependent Selective Peptide Recognition by a G Protein-Coupled Receptor.
25881990 2015 Association of RAMP1?rs7590387 with the risk of migraine transformation into medication overuse headache.
24454825 2014 Role of receptor activity modifying protein 1 in function of the calcium sensing receptor in the human TT thyroid carcinoma cell line.
23867798 2013 RAMP1 is a direct NKX3.1 target gene up-regulated in prostate cancer that promotes tumorigenesis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23237777 2013 Association study of the calcitonin gene-related polypeptide-alpha (CALCA) and the receptor activity modifying 1 (RAMP1) genes with migraine.
22949393 2013 The influence of RAMP1 overexpression on CGRP-induced osteogenic differentiation in MG-63 cells in vitro: an experimental study.
22484227 2012 Localization of calcitonin receptor-like receptor (CLR) and receptor activity-modifying protein 1 (RAMP1) in human gastrointestinal tract.
22208649 2012 Calcitonin gene-related peptide and its receptor components in the human sphenopalatine ganglion -- interaction with the sensory system.
More...