Property Summary

Ligand Count 1
NCBI Gene PubMed Count 56
PubMed Score 148.47
PubTator Score 78.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

AA Sequence

MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELA      1 - 70
DCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQ     71 - 140
SKRTEGIV                                                                  141 - 148
//

Text Mined References (56)

PMID Year Title