Property Summary

NCBI Gene PubMed Count 35
PubMed Score 53.61
PubTator Score 47.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Intellectual disability 1016
Attention deficit hyperactivity disorder 278
Autistic Disorder 364
Big calvaria 147
Bulging forehead 66
Cerebellar Dysmetria 56
Cerebellar Hypoplasia 61
Class III malocclusion 78
Cognitive delay 608
Congenital hypoplasia of penis 176
Cryptorchidism 296
Delayed speech and language development 112
Disorganization of the anterior cerebellar vermis 1
Dull intelligence 645
Enlarged cisterna magna 2
Enophthalmos 75
Epilepsy 792
Frontal bossing 157
Gait Ataxia 51
Global developmental delay 608
Hyperactive behavior 91
Hyperplasia of supraorbital margins 19
Hyperplasia of supraorbital ridge 19
Hypertrophy of lower jaw 78
Hypertrophy of supraorbital margins 19
Hypertrophy of supraorbital ridge 19
Hypoplasia of scrotum 24
Increased head circumference 147
Increased size of cranium 147
Increased size of mandible 78
Increased size of skull 147
Infantile onset 238
Language Delay 112
Large auricle 87
Large dysplastic ears 87
Large pinnae 87
Large prominent ears 87
Large protruding ears 87
Large, floppy ears 87
Long face 71
Long nose 15
Low intelligence 645
Macrotia 87
Mandibular hyperplasia 78
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Muscle Spasticity 195
Muscle hypotonia 571
Nystagmus 317
Orbital separation diminished 23
Poor school performance 645
Prominent forehead 66
Prominent supraorbital ridges 19
Retrocerebellar cyst 2
Seizures 596
Short philtrum 53
Small penis 5
Speech Delay 112
Speech Disorders 58
Speech impairment 112
Strabismus 270
Sunken eyes 63
Thin upper lip vermilion 67
X- linked recessive 110
mandibular excess (physical finding) 78
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

Gene RIF (20)

AA Sequence

MGHPPLEFSDCYLDSPDFRERLKCYEQELERTNKFIKDVIKDGNALISAMRNYSSAVQKFSQTLQSFQFD      1 - 70
FIGDTLTDDEINIAESFKEFAELLNEVENERMMMVHNASDLLIKPLENFRKEQIGFTKERKKKFEKDGER     71 - 140
FYSLLDRHLHLSSKKKESQLQEADLQVDKERHNFFESSLDYVYQIQEVQESKKFNIVEPVLAFLHSLFIS    141 - 210
NSLTVELTQDFLPYKQQLQLSLQNTRNHFSSTREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWAL    211 - 280
GISWVKYYCQYEKETKTLTMTPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQA    281 - 350
LSEANRRLWMEAMDGKEPIYHSPITKQQEMELNEVGFKFVRKCINIIETKGIKTEGLYRTVGSNIQVQKL    351 - 420
LNAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDYRLGAIHSLVY    421 - 490
KLPEKNREMLELLIRHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQEDTVAAMMNIKFQNIVVEILIEHF    491 - 560
GKIYLGPPEESAAPPVPPPRVTARRHKPITISKRLLRERTVFYTSSLDESEDEIQHQTPNGTITSSIEPP    561 - 630
KPPQHPKLPIQRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTK    631 - 700
TPSFHIKRPAPRPLAHHKEGDADSFSKVRPPGEKPTIIRPPVRPPDPPCRAATPQKPEPKPDIVAGNAGE    701 - 770
ITSSVVASRTRFFETASRKTGSSQGRLPGDES                                          771 - 802
//

Text Mined References (36)

PMID Year Title