Property Summary

NCBI Gene PubMed Count 117
Grant Count 179
R01 Count 96
Funding $29,350,312.66
PubMed Score 2922.87
PubTator Score 236.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.796 0.001
Rheumatoid Arthritis 2.700 0.000
astrocytoma 2.200 0.000
juvenile dermatomyositis 1.188 0.000
pancreatic ductal adenocarcinoma liver m... 1.458 0.026
tuberculosis and treatment for 6 months -1.200 0.000
lung cancer 1.500 0.000
ovarian cancer 2.200 0.000

Synonym

Accession O60885 O60433 Q4G0X8 Q86YS8 Q96PD3
Symbols CAP
MCAP
HUNK1
HUNKI

Gene

PDB

2NCZ   2ND1   3UVW   3UVX   3UVY   3UW9   2LSP   4KV1   4KV4   2I8N   2MJV   2N3K   2ND0   2NNU   2OSS   2OUO   2YEL   2YEM   3MXF   3P5O   3SVF   3SVG   3U5J   3U5K   3U5L   3ZYU   4A9L   4BJX   4BW1   4BW2   4BW3   4BW4   4C66   4C67   4CFK   4CFL   4CL9   4CLB   4DON   4E96   4F3I   4GPJ   4HBV   4HBW   4HBX   4HBY   4HXK   4HXL   4HXM   4HXN   4HXO   4HXP   4HXR   4HXS   4IOO   4IOQ   4IOR   4J0R   4J0S   4J3I   4LR6   4LRG   4LYI   4LYS   4LYW   4LZR   4LZS   4MEN   4MEO   4MEP   4MEQ   4MR3   4MR4   4NQM   4NR8   4NUC   4NUD   4NUE   4O70   4O71   4O72   4O74   4O75   4O76   4O77   4O78   4O7A   4O7B   4O7C   4O7E   4O7F   4OGI   4OGJ   4PCE   4PCI   4PS5   4QB3   4QR3   4QR4   4QR5   4QZS   4UIX   4UIY   4UIZ   4UYD   4WHW   4WIV   4X2I   4XY9   4XYA   4YH3   4YH4   4Z1Q   4Z1S   4Z93   4ZC9   4ZW1   5A5S   5A85   5ACY   5BT4   5CFW   5COI   5CP5   5CPE   5CQT   5CRM   5CRZ   5CS8   5CTL   5CY9   5D0C   5D24   5D25   5D26   5D3H   5D3J   5D3L   5D3N   5D3P   5D3R   5D3S   5D3T   5DLX   5DLZ   5DW2   5DX4   5EGU   5EI4   5EIS   5FBX   5HLS   5HM0   5JWM   5KHM   5LJ1   5LJ2  

Gene RIF (118)

PMID Text
26858406 findings identify key structural features of the ET domain of Brd4 that allow for interactions with both cellular and viral proteins.
26855180 we found that NF-kappaB, BRD4 and RNA POL II were rapidly distributed at the upstream regions of miR-146a and miR-155, and more importantly mediated the formation of the super enhancers that drive miR-146a and miR-155 transcription.
26752646 the long noncoding RNA colon cancer-associated transcript 1 (CCAT1) is transcribed from this superenhancer and is exquisitely sensitive to BET inhibition.
26707881 In conclusion, our findings revealed that the aberrant expression of BRD4 in thyroid cancer is possibly involved in tumor progression, and JQ1 is potentially an effective chemotherapeutic agent against human thyroid cancer.
26626481 Study provides evidence that links the CHD8 chromatin remodeler to the cancer maintenance functions of BRD4 and NSD3.
26504077 novel actions of BRD4 and of NELF-E in GR-controlled gene induction have been uncovered.
26365679 HPV16 E2-Brd4 interaction is more responsible for the transcriptional activation of host genes rather than repression.
26324948 This study implicates BET Brds as important regulators of IkappaB kinase/NF-kappaB-mediated synovial inflammation of RA and identifies BET proteins as novel therapeutic targets in inflammatory arthritis.
26224795 BRD4 plays a key role in the pathological phenotype of pulmonary arterial hypertension.
26220994 discovered that the translocation oncoprotein BRD4-NUT protein occupies approximately 100-200 extremely broad, cell type-specific hyperacetylated domains in the genome
More...

AA Sequence

MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVV      1 - 70
LKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYN     71 - 140
KPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQT    141 - 210
PQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQ    211 - 280
PVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKV    281 - 350
SEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA    351 - 420
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSS    421 - 490
DSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEEN    491 - 560
KKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKL    561 - 630
GRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS    631 - 700
SESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPP    701 - 770
QQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP    771 - 840
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQ    841 - 910
VLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPP    911 - 980
QPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHK    981 - 1050
SDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPII   1051 - 1120
RSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAP   1121 - 1190
KKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM   1191 - 1260
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARK   1261 - 1330
REQERRRREAMAATIDMNFQSDLLSIFEENLF                                         1331 - 1362
//

Text Mined References (146)

PMID Year Title
26858406 2016 Structure of the Brd4 ET domain bound to a C-terminal motif from ?-retroviral integrases reveals a conserved mechanism of interaction.
26855180 2016 Super enhancers at the miR-146a and miR-155 genes contribute to self-regulation of inflammation.
26752646 2016 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer.
26707881 2016 Inhibition of BRD4 suppresses tumor growth and enhances iodine uptake in thyroid cancer.
26626481 2015 NSD3-Short Is an Adaptor Protein that Couples BRD4 to the CHD8 Chromatin Remodeler.
26504077 2016 Kinetically Defined Mechanisms and Positions of Action of Two New Modulators of Glucocorticoid Receptor-regulated Gene Induction.
26365679 2016 Failure to interact with Brd4 alters the ability of HPV16 E2 to regulate host genome expression and cellular movement.
26324948 2016 Bromodomain and extra-terminal domain bromodomain inhibition prevents synovial inflammation via blocking I?B kinase-dependent NF-?B activation in rheumatoid fibroblast-like synoviocytes.
26224795 2015 Bromodomain-Containing Protein 4: The Epigenetic Origin of Pulmonary Arterial Hypertension.
26220994 2015 The oncogenic BRD4-NUT chromatin regulator drives aberrant transcription within large topological domains.
More...