Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.70
PubTator Score 21.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.6e-05
psoriasis 6694 3.6e-05
ovarian cancer 8520 6.8e-05
glioblastoma 5792 3.3e-04

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.100 3.3e-04
osteosarcoma 1.092 2.6e-05
ovarian cancer -1.300 6.8e-05
psoriasis 1.700 3.6e-05

Gene RIF (7)

AA Sequence

MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYG      1 - 70
EQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKN     71 - 140
VLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKV    141 - 210
IKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALC    211 - 280
GFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSE    281 - 350
LEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ            351 - 412
//

Text Mined References (29)

PMID Year Title