Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.94
PubTator Score 21.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma -1.269 0.001
glioblastoma -1.100 0.000
ovarian cancer 1.400 0.003

Synonym

Accession O60884 B2R7L7 O14711
Symbols DJ3
CPR3
DJA2
DNAJ
DNJ3
RDJ2
HIRIP4
PRO3015

Gene

Gene RIF (6)

PMID Text
24318877 we combined the Hsp70-NEF pairs with cochaperones of the J protein family (DnaJA1, DnaJA2, DnaJB1, and DnaJB4) to generate 16 permutations.
23091061 The DNAJA2 substrate release mechanism is essential for chaperone-mediated folding.
19940115 Hsp40 type 1 chaperones DJA1 (DNAJA1/Hdj2) and DJA2 (DNAJA2) as key modulators of hERG degradation
18976975 Knockdown of DnaJ (Hsp40) homolog, subfamily A, member 2 (DNAJA2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18684711 Bag1 NEF increased refolding by Hsc70 and DJA2, as did the newly characterized NEF Hsp110
18595009 Rdj2 modulates G protein signaling and further suggest that chaperoning G proteins is an emerging theme of the J protein network.

AA Sequence

MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYG      1 - 70
EQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKN     71 - 140
VLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKV    141 - 210
IKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALC    211 - 280
GFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSE    281 - 350
LEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ            351 - 412
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23091061 2012 The DNAJA2 substrate release mechanism is essential for chaperone-mediated folding.
22085931 2012 Optimal functional levels of activation-induced deaminase specifically require the Hsp40 DnaJa1.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19940115 2010 Hsp40 chaperones promote degradation of the HERG potassium channel.
More...