Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.15
PubTator Score 4.33

Knowledge Summary

Patent (1,508)

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 3.3e-03
atypical teratoid / rhabdoid tumor -2.800 4.1e-05
ependymoma 1.100 2.0e-04
glioblastoma -1.100 3.2e-02
group 3 medulloblastoma -1.400 1.8e-04
medulloblastoma, large-cell -1.300 8.9e-05
pediatric high grade glioma -2.100 1.1e-04
primitive neuroectodermal tumor -2.100 4.8e-02

Gene RIF (4)

AA Sequence

MRWLWPLAVSLAVILAVGLSRVSGGAPLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRP      1 - 70
IHPAGLQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSAYAIMLLALVV     71 - 140
FAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVLFFCLPIVIFNEITKQRLLGDVSCRAVPFME    141 - 210
VSSLGVTTFSLCALGIDRFHVATSTLPKVRPIERCQSILAKLAVIWVGSMTLAVPELLLWQLAQEPAPTM    211 - 280
GTLDSCIMKPSASLPESLYSLVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKH    281 - 350
EQCESQLNSTVVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCIC    351 - 420
RPLGQAFLDCCCCCCCEECGGASEASAANGSDNKLKTEVSSSIYFHKPRESPPLLPLGTPC             421 - 481
//

Text Mined References (14)

PMID Year Title