Property Summary

NCBI Gene PubMed Count 31
Grant Count 83
R01 Count 56
Funding $6,834,633.16
PubMed Score 70.98
PubTator Score 46.60

Knowledge Summary

Patent

No data available

Synonym

Accession O60882 Q6DKT9 MMP-20
Symbols AI2A2
MMP-20

Gene

PDB

2JSD  

Gene RIF (24)

PMID Text
26558991 The expression of MMP20 was lower in calcifying cystic odontogenic tumor when compared to all tumors and cysts.
26337002 The growth of choroidal neovascularization in AMD would be affected by 2 genes: MMP20, a newly confirmed gene expressed in the retina, and ARMS2/HTRA1, a well-known susceptibility gene for AMD.
26124219 Novel homozygous mutation MMP20 (c.1054G>A, p.Glu352Lys) genes were identified in amelogenesis imperfect consanguinity. Mutant MMP20 was expressed at a normal level but secreted only minimally with proteolytic function.
25805840 expression of MMP-20 and co-expression and potential interaction with DSPP in human major salivary gland tissues
23953525 Polymorphisms of MMP7 and MMP20 genes may be surrogate markers to predict long-term outcomes after kidney transplantation.
23625376 mineralized content slightly decreased; magnesium substituting for calcium in crystal. anomalies affected enamel with minimal interrod enamel; apatite crystals perpendicular to enamel prisms, suggesting possible new role for MMP20 in enamel formation.
23355523 amelogenesis imperfecta-causing mutations were identified in three of the probands: 2)a novel missense transition mutation in both MMP20 alleles (g.15390A>G; c.611A>G; p.His204Arg) that substituted arginine for histidine.
23241590 The results identify MMP-20 as a broad activator of pro-KLKs, suggesting the potential for intersection of the KLK and MMP axes under pathological dysregulation of MMP-20 expression.
22330321 Variation in MMP20 may be associated with caries experience mainly in Caucasian subjects with poor oral health habits.
21504268 hypocalcified amelogenesis imperfecta, Witkop type III, was unrelated to previously described mutations in the ENAM or MMP-20 genes
More...

AA Sequence

MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIR      1 - 70
KIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDK     71 - 140
AVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEK    141 - 210
WTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKP    211 - 280
TLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAA    281 - 350
YEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDER    351 - 420
KRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC           421 - 483
//

Text Mined References (33)

PMID Year Title
26558991 2015 Immunohistochemical expression of WNT5A and MMPs in odontogenic epithelial tumors and cysts.
26337002 2015 MMP20 and ARMS2/HTRA1 Are Associated with Neovascular Lesion Size in Age-Related Macular Degeneration.
26124219 2015 Novel MMP20 and KLK4 Mutations in Amelogenesis Imperfecta.
25805840 2015 Expression of Matrix Metalloproteinase (MMP)-20 and Potential Interaction with Dentin Sialophosphoprotein (DSPP) in Human Major Salivary Glands.
23953525 Identification of the effects of aging-related gene-matrix metalloproteinase on allograft outcomes in kidney transplantation.
23625376 2013 Homozygous and compound heterozygous MMP20 mutations in amelogenesis imperfecta.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23355523 2013 Novel KLK4 and MMP20 mutations discovered by whole-exome sequencing.
23241590 2013 Activation profiles of human kallikrein-related peptidases by matrix metalloproteinases.
22330321 2012 Genetic variation in MMP20 contributes to higher caries experience.
More...