Property Summary

NCBI Gene PubMed Count 115
PubMed Score 453.32
PubTator Score 400.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 2.600 4.1e-04
head and neck cancer and chronic obstruc... 1.100 9.6e-03
interstitial cystitis 2.500 2.3e-03
lung cancer -1.100 3.9e-02
osteosarcoma -2.711 9.0e-04
primary Sjogren syndrome 1.600 1.5e-03
psoriasis 1.500 1.0e-41
sarcoidosis 1.600 2.5e-02
ulcerative colitis 1.200 5.3e-03

Gene RIF (75)

AA Sequence

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAP      1 - 70
GVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP                 71 - 128
//

Text Mined References (123)

PMID Year Title