Property Summary

NCBI Gene PubMed Count 22
Grant Count 14
R01 Count 10
Funding $1,486,021.12
PubMed Score 193.68
PubTator Score 282.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.719 0.000
group 3 medulloblastoma 1.200 0.005
ovarian cancer 1.200 0.005

Gene RIF (13)

PMID Text
24755081 overexpression of KIN rendered colorectal cancer cells enriching cancer stem cell (CSC) markers and CSC phenotype, and silencing KIN reduced CSC markers and CSC phenotype.
23349634 Trimethylated at Lys-135 by METTL22
21980430 up-regulation of kin17 is strongly associated with cellular proliferation, DNA replication, DNA damage response and breast cancer development
18029424 Thus, human KIN17 region 51-160 might rather be involved in protein-protein interaction through its conserved surface centered on the 3(10)-helix.
17045609 Analysis of KIN17 structure complexed with tungstate shows structural variability within the domain
16511313 C-terminal domain of human KIN17 has a basic pI, heavy-atom derivatives were obtained by soaking crystals with negatively charged ions such as tungstate & iodine. Replacement of LiCl by KI in cryosolution allowed determination of phases from iodide ions.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15831485 Kin17 protein strongly associates in vivo with DNA fragments containing replication origins in both human HeLa and monkey CV-1 cells.
12754299 A chromatin-associated protein conserved during evolution and overproduced in certain human tumor cell lines, which is involved in DNA replication.
12751957 KIN17 protein may be a component of the DNA replication machinery that participates in the cellular response to unrepaired DSBs, and an impaired KIN17 pathway leads to an increased sensitivity to ionizing radiation.
More...

AA Sequence

MGKSDFLTPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASENPQQFMDYFSE      1 - 70
EFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQ     71 - 140
YIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKG    141 - 210
ACSSSGATSSKSSTLGPSALKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDYW    211 - 280
LQPEIIVKIITKKLGEKYHKKKAIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGY    281 - 350
RGNEGTLESINEKTFSATIVIETGPLKGRRVEGIQYEDISKLA                               351 - 393
//

Text Mined References (29)

PMID Year Title
24755081 2014 KIN enhances stem cell-like properties to promote chemoresistance in colorectal carcinoma.
24140279 2014 Methylation of the DNA/RNA-binding protein Kin17 by METTL22 affects its association with chromatin.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21980430 2011 Up-regulation of kin17 is essential for proliferation of breast cancer.
21269460 2011 Initial characterization of the human central proteome.
18029424 2007 Solution structure of the region 51-160 of human KIN17 reveals an atypical winged helix domain.
17045609 2006 A tandem of SH3-like domains participates in RNA binding in KIN17, a human protein activated in response to genotoxics.
16636754 2006 NMR assignment of region 51-160 of human KIN17, a DNA and RNA-binding protein.
More...