Property Summary

NCBI Gene PubMed Count 23
PubMed Score 226.16
PubTator Score 282.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.7e-07
group 3 medulloblastoma 4104 5.3e-03
ovarian cancer 8520 5.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Carpal tunnel syndrome 20 3.535 1.8
Actinic keratosis 21 3.099 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 5.3e-03
osteosarcoma -1.719 7.7e-07
ovarian cancer 1.200 5.5e-03

Gene RIF (14)

AA Sequence

MGKSDFLTPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASENPQQFMDYFSE      1 - 70
EFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQ     71 - 140
YIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKG    141 - 210
ACSSSGATSSKSSTLGPSALKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDYW    211 - 280
LQPEIIVKIITKKLGEKYHKKKAIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGY    281 - 350
RGNEGTLESINEKTFSATIVIETGPLKGRRVEGIQYEDISKLA                               351 - 393
//

Text Mined References (30)

PMID Year Title