Property Summary

NCBI Gene PubMed Count 19
Grant Count 3
Funding $177,849
PubMed Score 65.07
PubTator Score 28.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.227 0.002
psoriasis 1.600 0.000
osteosarcoma -1.889 0.000
diabetes mellitus -1.400 0.002
Polycystic Ovary Syndrome 1.076 0.007
ovarian cancer 2.500 0.000
dermatomyositis 1.300 0.000

Synonym

Accession O60869 Q5T5T2 Q9UIM1 EDF-1
Symbols MBF1
EDF-1
CFAP280

Gene

PDB

1X57  

Gene RIF (4)

PMID Text
21782027 According to this study multiprotein bridging factor 1 and Calmodulin do not interact in vitro as confirmed by NMR spectroscopy and CaM-agarose affinity chromatography.
16567061 The EDF-1 minimal promoter was characterized.
12040021 Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism.
9813014 HIV-1 Tat, which affects endothelial functions, downregulates EDF-1 expression both at the RNA and protein levels

AA Sequence

MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH      1 - 70
DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP     71 - 140
IEKGPRAK                                                                  141 - 148
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24008843 2013 Structure homology and interaction redundancy for discovering virus-host protein interactions.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...