Property Summary

NCBI Gene PubMed Count 19
PubMed Score 67.22
PubTator Score 28.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.3e-05
osteosarcoma 7950 4.4e-05
psoriasis 6694 1.0e-04
dermatomyositis 966 3.2e-04
diabetes mellitus 1728 1.6e-03
Multiple myeloma 1332 1.6e-03
Polycystic ovary syndrome 360 6.7e-03

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.300 3.2e-04
diabetes mellitus -1.400 1.6e-03
Multiple myeloma 1.227 1.6e-03
osteosarcoma -1.889 4.4e-05
ovarian cancer -1.200 2.3e-05
Polycystic ovary syndrome 1.076 6.7e-03
psoriasis 1.600 1.0e-04

Gene RIF (4)

AA Sequence

MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH      1 - 70
DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP     71 - 140
IEKGPRAK                                                                  141 - 148
//

Text Mined References (26)

PMID Year Title