Property Summary

NCBI Gene PubMed Count 19
PubMed Score 65.07
PubTator Score 28.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.01151655241843E-6
osteosarcoma 7933 4.35685389694616E-5
psoriasis 6685 1.0368862883213E-4
dermatomyositis 967 3.16005824383606E-4
diabetes mellitus 1663 0.00159600106628052
Multiple myeloma 1328 0.00161342834308776
Polycystic Ovary Syndrome 335 0.00673878134104112

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.227 0.002
psoriasis 1.600 0.000
osteosarcoma -1.889 0.000
diabetes mellitus -1.400 0.002
Polycystic Ovary Syndrome 1.076 0.007
ovarian cancer 2.500 0.000
dermatomyositis 1.300 0.000

Synonym

Accession O60869 Q5T5T2 Q9UIM1 EDF-1
Symbols MBF1
EDF-1
CFAP280

Gene

PDB

1X57  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
21782027 According to this study multiprotein bridging factor 1 and Calmodulin do not interact in vitro as confirmed by NMR spectroscopy and CaM-agarose affinity chromatography.
16567061 The EDF-1 minimal promoter was characterized.
12040021 Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism.
9813014 HIV-1 Tat, which affects endothelial functions, downregulates EDF-1 expression both at the RNA and protein levels

AA Sequence

MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH      1 - 70
DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP     71 - 140
IEKGPRAK                                                                  141 - 148
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24008843 2013 Structure homology and interaction redundancy for discovering virus-host protein interactions.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...