Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 5
Funding $275,949.01
PubMed Score 25.51
PubTator Score 12.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26506240 Low GAS7C increases cancer cell motility by promoting N-WASP/FAK/F-actin cytoskeleton dynamics. It also enhances beta-catenin stability via hnRNP U/beta-TrCP complex formation.
24151073 We conclude that lower neuronal Gas7b levels may impact Alzheimer disease progression.
22662195 These findings indicate that Gas7 is involved in motor neuron function associated with muscle strength maintenance.
22570627 Intraocular pressure (IOP)was significantly associated with rs11656696, located in GAS7 at 17p13.1 and with rs7555523, located in TMCO1 at 1q24.1.These data suggest that we have identified two clinically relevant genes involved in IOP regulation.
22496485 The results suggest that regulation to maintain an appropriate concentration of hGas7b is required for healthy neurotransmission.
21452305 regulates the differentiation of mesenchymal stem cells into osteoblasts by enhancing Runx2-dependent gene expression
20890993 Knockdown of Gas7 by shRNA preferentially suppressed the Gas7b protein isoform in human preneuronal cells and to reduce apoptosis induced either by serum starvation or by the antineoplastic agents in human neuroblastoma SH-SY5Y cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLLEKPGMVPPPP      1 - 70
GEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVNGYHASGTPAH     71 - 140
PPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD    141 - 210
PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK    211 - 280
SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL    281 - 350
EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR    351 - 420
QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI                  421 - 476
//

Text Mined References (31)

PMID Year Title
26506240 2015 Growth-arrest-specific 7C protein inhibits tumor metastasis via the N-WASP/FAK/F-actin and hnRNP U/?-TrCP/?-catenin pathways in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
24151073 2013 Gas7b (growth arrest specific protein 7b) regulates neuronal cell morphology by enhancing microtubule and actin filament assembly.
24002674 2014 Genome-wide association study and meta-analysis of intraocular pressure.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22662195 2012 Gas7-deficient mouse reveals roles in motor function and muscle fiber composition during aging.
22570627 2012 Common genetic determinants of intraocular pressure and primary open-angle glaucoma.
22496485 2012 Alzheimer's disease-related protein hGas7b interferes with kinesin motility.
21452305 2011 Gas7 mediates the differentiation of human bone marrow-derived mesenchymal stem cells into functional osteoblasts by enhancing Runx2-dependent gene expression.
More...