Property Summary

NCBI Gene PubMed Count 32
PubMed Score 28.84
PubTator Score 12.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -1.800 1.0e-03
astrocytic glioma -1.500 8.3e-03
Astrocytoma, Pilocytic -2.100 2.8e-05
atypical teratoid / rhabdoid tumor -3.400 3.5e-09
breast carcinoma -1.400 1.4e-19
colon cancer -2.000 5.5e-03
ductal carcinoma in situ -1.100 3.8e-02
ependymoma -1.600 6.8e-06
esophageal adenocarcinoma -1.300 1.8e-02
gastric carcinoma 1.400 4.1e-02
glioblastoma -2.200 9.5e-07
group 3 medulloblastoma -2.600 2.1e-04
intraductal papillary-mucinous adenoma (... -1.400 3.9e-02
intraductal papillary-mucinous carcinoma... -1.400 3.6e-02
intraductal papillary-mucinous neoplasm ... -2.000 3.4e-02
invasive ductal carcinoma -1.312 3.6e-02
lung cancer -2.800 1.3e-05
medulloblastoma, large-cell -3.700 2.5e-07
non-small cell lung cancer -1.179 1.1e-09
oligodendroglioma -1.200 4.8e-02
ovarian cancer -1.700 9.6e-10
Pick disease -1.200 1.8e-02
primitive neuroectodermal tumor -2.600 2.0e-04
psoriasis -1.100 3.4e-03
Rheumatoid arthritis 1.100 3.4e-03
subependymal giant cell astrocytoma -2.879 4.3e-02
tuberculosis and treatment for 6 months -1.100 1.0e-03

Gene RIF (17)

AA Sequence

MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLLEKPGMVPPPP      1 - 70
GEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVNGYHASGTPAH     71 - 140
PPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD    141 - 210
PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK    211 - 280
SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL    281 - 350
EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR    351 - 420
QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI                  421 - 476
//

Text Mined References (35)

PMID Year Title