Property Summary

NCBI Gene PubMed Count 24
PubMed Score 942.94
PubTator Score 232.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 1.17540883816368E-12
tuberculosis and treatment for 6 months 686 4.09065948811646E-7
acute quadriplegic myopathy 1157 5.05044948334086E-7
Pick disease 1893 5.05145880912319E-7
ovarian cancer 8492 1.77441052602323E-5
group 3 medulloblastoma 2254 2.56708428125237E-5
osteosarcoma 7933 1.07465617937727E-4
hepatocellular carcinoma 550 2.51708443296395E-4
cystic fibrosis 1670 0.00154866005821315
pancreatic cancer 2300 0.00466674158522631
pancreatic carcinoma 567 0.00466674158522641
progressive supranuclear palsy 674 0.00837149020465068
glioblastoma 5572 0.00940967309212705
Alzheimer's disease 644 0.0145742616654345
esophageal adenocarcinoma 737 0.0177498559902329
sarcoidosis 368 0.0179162870539772
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (16)

Disease log2 FC p
hepatocellular carcinoma 1.800 0.000
pancreatic cancer 1.300 0.005
esophageal adenocarcinoma -1.100 0.018
osteosarcoma 2.777 0.000
group 3 medulloblastoma 1.500 0.000
cystic fibrosis -1.154 0.002
glioblastoma -1.200 0.009
acute quadriplegic myopathy 1.044 0.000
tuberculosis and treatment for 6 months -1.900 0.000
sarcoidosis 1.300 0.018
pancreatic carcinoma 1.300 0.005
lung adenocarcinoma -1.500 0.000
Alzheimer's disease 1.800 0.015
Pick disease 2.500 0.000
progressive supranuclear palsy 2.000 0.008
ovarian cancer 2.200 0.000

Synonym

Accession O60858 B2RB49 Q5UBW0 Q5W0U8 Q5W0U9 Q9BQ47 Q9C021
Symbols CAR
LEU5
RFP2
DLEU5
RNF77

Gene

  Ortholog (13)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (8)

PMID Text
25152375 TRIM13 mediated NF-kappaB repression is essential for negative regulation of clonogenic ability of the cells.
24565866 Results show that HRD1 and RFP2 contributes are required for the disposal of V247M alpha-sarcoglycan mutant.
24021263 This study first time demonstrated the role of TRIM13 as novel regulator of caspase-8 activation and cell death during endoplasmic reticulum stress.
23647456 Shows important roles of TRIM13 in MM tumour survival and proliferation in multiple myeloma.
22178386 Results describe the role of TRIM13 in induction of autophagy, which may play an important role in regulation of ER stress and tumor suppression.
21333377 Data suggest that irradiation causes RFP2 overexpression, which enhances ionizing radiation-induced apoptosis by increasing p53 stability and decreasing AKT kinase activity through MDM2 and AKT degradation.
17314412 Rfp2 contains a C-terminal transmembrane domain indispensable for its localization to the ER
16499869 TRIM13, also known as RFP2, promoter area contains multiple quadruplex forming GGGGA-repeats that possesses unusually hight activity, anomalously high electrostatic fields induced by sequence-dependent dipoles and very low nucleosome forming potential.

AA Sequence

MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQ      1 - 70
VNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERD     71 - 140
AFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLA    141 - 210
VMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKN    211 - 280
FDTSQWEDIKLVDVDKLSLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGC    281 - 350
LSNFSSYLTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL                 351 - 407
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25152375 2014 TRIM13 regulates ubiquitination and turnover of NEMO to suppress TNF induced NF-?B activation.
24565866 2014 Unveiling the degradative route of the V247M ?-sarcoglycan mutant responsible for LGMD-2D.
24021263 2013 TRIM13 regulates caspase-8 ubiquitination, translocation to autophagosomes and activation during ER stress induced cell death.
23647456 2013 TRIM13 (RFP2) downregulation decreases tumour cell growth in multiple myeloma through inhibition of NF Kappa B pathway and proteasome activity.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22178386 2012 TRIM13 regulates ER stress induced autophagy and clonogenic ability of the cells.
21333377 2011 Ret finger protein 2 enhances ionizing radiation-induced apoptosis via degradation of AKT and MDM2.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
More...