Property Summary

NCBI Gene PubMed Count 24
PubMed Score 962.93
PubTator Score 232.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.044 5.1e-07
Alzheimer's disease 1.800 1.5e-02
cystic fibrosis -1.154 1.5e-03
esophageal adenocarcinoma -1.100 1.8e-02
glioblastoma -1.200 9.4e-03
group 3 medulloblastoma 1.500 2.6e-05
hepatocellular carcinoma 1.800 2.5e-04
lung adenocarcinoma -1.500 1.2e-12
osteosarcoma -1.229 1.5e-04
ovarian cancer -1.900 9.4e-10
pancreatic cancer 1.300 4.7e-03
pancreatic carcinoma 1.300 4.7e-03
Pick disease 2.500 5.1e-07
progressive supranuclear palsy 2.000 8.4e-03
sarcoidosis 1.300 1.8e-02
tuberculosis -1.100 9.9e-03

Gene RIF (8)

AA Sequence

MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQ      1 - 70
VNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERD     71 - 140
AFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLA    141 - 210
VMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKN    211 - 280
FDTSQWEDIKLVDVDKLSLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGC    281 - 350
LSNFSSYLTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL                 351 - 407
//

Text Mined References (24)

PMID Year Title