Property Summary

NCBI Gene PubMed Count 14
PubMed Score 46.93
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
primary pancreatic ductal adenocarcinoma 1109 2.9e-03
active ulcerative colitis 764 4.6e-03
colon cancer 1478 3.9e-02
Disease Target Count Z-score Confidence
Adenomyoma 1 3.972 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis -2.470 4.6e-03
colon cancer -2.000 3.9e-02
primary pancreatic ductal adenocarcinoma -1.176 2.9e-03

 GO Function (1)

 GO Process (1)

Gene RIF (4)

AA Sequence

MLTVALLALLCASASGNAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGK      1 - 70
VWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLR     71 - 140
FISGRSGSLIDAIGLHWDVYPSSCSRC                                               141 - 167
//

Text Mined References (16)

PMID Year Title