Property Summary

NCBI Gene PubMed Count 14
PubMed Score 45.63
PubTator Score 8.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.176 0.003
colon cancer -6.500 0.000
active ulcerative colitis -2.470 0.005

Synonym

Accession O60844 B2R4Z3 B9EK72 Zymogen granule protein 16
Symbols JCLN
JCLN1
ZG16A

Gene

PDB

3APA   3VY6   3VY7   3VZE   3VZF   3VZG  

 GO Function (1)

 GO Process (1)

Gene RIF (4)

PMID Text
25919894 Pathogen-related glycan microarray analysis identified phosphatidylinositol mono- and di-mannosides (PIM1 and PIM2) as novel ligand candidates of ZG16p.
21893569 Human ZG16p recognizes pathogenic fungi through non-self polyvalent mannose in the digestive system.
21110947 the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site.
17307141 hZG16 was markedly down-regulated in hepatocellular carcinoma (HCC) as indicated by RT-PCR.

AA Sequence

MLTVALLALLCASASGNAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGK      1 - 70
VWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLR     71 - 140
FISGRSGSLIDAIGLHWDVYPSSCSRC                                               141 - 167
//

Text Mined References (16)

PMID Year Title
25919894 2015 Defining the Interaction of Human Soluble Lectin ZG16p and Mycobacterial Phosphatidylinositol Mannosides.
25416956 2014 A proteome-scale map of the human interactome network.
21893569 2012 Human ZG16p recognizes pathogenic fungi through non-self polyvalent mannose in the digestive system.
21110947 2011 Crystal structures of human secretory proteins ZG16p and ZG16b reveal a Jacalin-related ?-prism fold.
17307141 2007 hZG16, a novel human secreted protein expressed in liver, was down-regulated in hepatocellular carcinoma.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...