Property Summary

NCBI Gene PubMed Count 24
PubMed Score 528.28
PubTator Score 127.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.022 1.8e-02
acute myeloid leukemia 4.000 4.1e-02
Becker muscular dystrophy -1.245 2.6e-04
group 4 medulloblastoma -1.100 2.4e-02
intraductal papillary-mucinous adenoma (... 1.400 3.3e-03
intraductal papillary-mucinous carcinoma... 1.300 8.3e-04
lung cancer 1.300 2.0e-04
ovarian cancer 1.300 7.7e-04
psoriasis 1.700 8.7e-05
tuberculosis and treatment for 3 months -1.100 3.8e-03
ulcerative colitis 1.200 4.2e-06

 GO Component (2)

Gene RIF (10)

AA Sequence

MGKKQKNKSEDSTKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILKELEELSLEAQ      1 - 70
GIKADRETVAVKPTENNEEEFTSKDKKKKGQKGKKQSFDDNDSEELEDKDSKSKKTAKPKVEMYSGSDDD     71 - 140
DDFNKLPKKAKGKAQKSNKKWDGSEEDEDNSKKIKERSRINSSGESGDESDEFLQSRKGQKKNQKNKPGP    141 - 210
NIESGNEDDDASFKIKTVAQKKAEKKERERKKRDEEKAKLRKLKEKEELETGKKDQSKQKESQRKFEEET    211 - 280
VKSKVTVDTGVIPASEEKAETPTAAEDDNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAK    281 - 350
LKEEEERQKREEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAE    351 - 420
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEVMEQGVPEKEETPPPV    421 - 490
EPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEEEEEDEESEEEEEEEGESEGS    491 - 560
EGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKRRIEKRRLEHSKNVNTEKLR    561 - 630
APIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLI    631 - 700
IDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDS    701 - 770
DVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVE    771 - 840
LTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPM    841 - 910
KELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIKLEEKG    911 - 980
VYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVMLEHDPQYAVILAFDVRIERDAQEMAD    981 - 1050
SLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVK   1051 - 1120
QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQS   1121 - 1190
IDALKDWFRDEMQKSDWQLIVELKKVFEII                                           1191 - 1220
//

Text Mined References (40)

PMID Year Title