Property Summary

NCBI Gene PubMed Count 22
Grant Count 295
R01 Count 179
Funding $40,065,582.21
PubMed Score 500.95
PubTator Score 127.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60841 O95805 Q53RV7 Q53SI8 Q9UF81 Q9UMN7 eIF-5B
Symbols IF2

Gene

 GO Component (2)

Gene RIF (9)

PMID Text
26362536 HIV-1 Gag interacts with EIF5B as demonstrated by proximity dependent biotinylation proteomics
25261552 eIF5B overexpression promotes maturation of G0-like immature oocytes and causes cell death, an alternative to G0, in serum-starved THP1 cells.
21697471 The authors show that the cleavage of initiation factor eIF5B during enteroviral infection, along with the viral internal ribosome entry site, plays a role in mediating viral translation under conditions that are nonpermissive for host cell translation.
18572216 3Cpro-mediated cleavage of eIF5B may thus play an accessory role in the shutoff of translation that occurs in enterovirus-infected cells.
17568775 binding of eIF5B might induce conformational changes in both subunits, with ribosomal segments wrapping around the factor
17161026 Transfected nuclear factor 2 trans activates the IF2 promoter in a cell line.
12569173 determination of binding site on eukaryotic initiation factor 1A
10432305 HIV-1 Gag interacts with EIF5B as demonstrated by proximity dependent biotinylation proteomics
10432305 HIV-1 Gag interacts with EIF5B as demonstrated by proximity dependent biotinylation proteomics

AA Sequence

MGKKQKNKSEDSTKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILKELEELSLEAQ      1 - 70
GIKADRETVAVKPTENNEEEFTSKDKKKKGQKGKKQSFDDNDSEELEDKDSKSKKTAKPKVEMYSGSDDD     71 - 140
DDFNKLPKKAKGKAQKSNKKWDGSEEDEDNSKKIKERSRINSSGESGDESDEFLQSRKGQKKNQKNKPGP    141 - 210
NIESGNEDDDASFKIKTVAQKKAEKKERERKKRDEEKAKLRKLKEKEELETGKKDQSKQKESQRKFEEET    211 - 280
VKSKVTVDTGVIPASEEKAETPTAAEDDNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAK    281 - 350
LKEEEERQKREEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAE    351 - 420
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEVMEQGVPEKEETPPPV    421 - 490
EPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEEEEEDEESEEEEEEEGESEGS    491 - 560
EGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKRRIEKRRLEHSKNVNTEKLR    561 - 630
APIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLI    631 - 700
IDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDS    701 - 770
DVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVE    771 - 840
LTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPM    841 - 910
KELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIKLEEKG    911 - 980
VYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVMLEHDPQYAVILAFDVRIERDAQEMAD    981 - 1050
SLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVK   1051 - 1120
QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQS   1121 - 1190
IDALKDWFRDEMQKSDWQLIVELKKVFEII                                           1191 - 1220
//

Text Mined References (38)

PMID Year Title
25261552 2014 Upregulation of eIF5B controls cell-cycle arrest and specific developmental stages.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21697471 2011 Poliovirus switches to an eIF2-independent mode of translation during infection.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
More...