Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $114,255
PubMed Score 15.48
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.200 0.003
ovarian cancer 1.100 0.000

Synonym

Accession O60831 B2RD20
Symbols JM4
Yip6a

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (7)

PMID Text
23440329 PRAF2 plays an essential role in neuroblastoma tumorigenesis and metastasis.
21203533 Praf2 is a novel Bcl-xL/Bcl-2 interacting protein with the ability to modulate survival of cancer cells
20412121 PRAF2 expression is elevated in various tumors with exceptionally high expression in malignant gliomas, and may thus presents a candidate molecular target for therapeutic intervention.
18395978 The expression of PRAF2 in specific regions of the brain including SVs suggest an important physiological function for this novel protein, possibly by participating in multiple aspects of SV maturation, transport, and signal transmission.
17975142 PRAF2 has a role in progression of neuroblastoma
16481131 CCR5-interacting PRAF2 protein is expressed in several human tissues with a possible function in ER/Golgi transport and vesicular traffic.
15757671 PRAF2 (JM4) is CCR5-interacting protein, which is suggested to function in trafficking and membrane localisation of the receptor.

AA Sequence

MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLS      1 - 70
ALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASL     71 - 140
RLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS                                    141 - 178
//

Text Mined References (13)

PMID Year Title
23440329 2013 PRAF2 stimulates cell proliferation and migration and predicts poor prognosis in neuroblastoma.
21269460 2011 Initial characterization of the human central proteome.
21203533 2010 Praf2 is a novel Bcl-xL/Bcl-2 interacting protein with the ability to modulate survival of cancer cells.
20412121 2010 Subcellular distribution and expression of prenylated Rab acceptor 1 domain family, member 2 (PRAF2) in malignant glioma: Influence on cell survival and migration.
18395978 2008 Expression profile of PRAF2 in the human brain and enrichment in synaptic vesicles.
17975142 2007 Expression of prenylated Rab acceptor 1 domain family, member 2 (PRAF2) in neuroblastoma: correlation with clinical features, cellular localization, and cerulenin-mediated apoptosis regulation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16481131 2006 Genomic organization, expression profile, and characterization of the new protein PRA1 domain family, member 2 (PRAF2).
16472945 2006 Genomic organization, characterization, and molecular 3D model of GDE1, a novel mammalian glycerophosphoinositol phosphodiesterase.
15757671 2005 JM4 is a four-transmembrane protein binding to the CCR5 receptor.
More...