Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.49
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 8.0e-05
group 3 medulloblastoma 4104 3.5e-03
Disease Target Count Z-score Confidence
Neuroblastoma 80 3.29 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.200 3.5e-03
ovarian cancer 1.100 8.0e-05

Gene RIF (8)

AA Sequence

MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLS      1 - 70
ALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASL     71 - 140
RLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS                                    141 - 178
//

Text Mined References (13)

PMID Year Title