1. Home
  2. Targets
  3. transfer/carrier protein
  4. mitochondrial carrier protein
  5. Mitochondrial import inner membrane translocase subunit Tim17-B

Tdark Mitochondrial import inner membrane translocase subunit Tim17-B

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

This gene encodes a multipass transmembrane protein that forms an integral component of the mitochondrial translocase TIM23 complex. This complex facilitates the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

 Comments

Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.20
PubTator Score 4.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.49648964169177E-6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 0.000

Synonym

Accession O60830 A8K2E2 J3KPV3 Q9UJV0
Symbols JM3
TIM17B
DXS9822

Gene

TIMM17B

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

 GO Function (1)

 GO Component (3)

 GO Process (2)

 Compartment GO Term (41)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (3)

 UniProt Keyword (11)

See all...

Gene RIF (2)

PMID Text
21947777 The findings of this study together provide the first evidence that EspZ localizes to host mitochondria and that TIM17b contributes to protection against rapid cell death during EPEC infection.
18854154 Knockdown of translocase of inner mitochondrial membrane 17 homolog B (TIMM17B) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence 

MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWG      1 - 70
GLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQ     71 - 140
FRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH                                          141 - 172
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
21947777 2011 The type III system-secreted effector EspZ localizes to host mitochondria and interacts with the translocase of inner mitochondrial membrane 17b.
21269460 2011 Initial characterization of the human central proteome.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...