Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.20
PubTator Score 4.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 2.5e-06

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 2.5e-06

Gene RIF (2)

AA Sequence

MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWG      1 - 70
GLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQ     71 - 140
FRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH                                          141 - 172
//

Text Mined References (15)

PMID Year Title