Property Summary

NCBI Gene PubMed Count 13
PubMed Score 20.50
PubTator Score 22.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Neoplasm Invasiveness 161 0.0 0.0
Disease Target Count Z-score Confidence
Prostate cancer 175 3.615 1.8

Expression

Gene RIF (7)

AA Sequence

MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEK      1 - 70
TRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP                                           71 - 102
//

Text Mined References (14)

PMID Year Title