Property Summary

NCBI Gene PubMed Count 13
Grant Count 17
Funding $4,742,311.8
PubMed Score 19.82
PubTator Score 22.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (7)

PMID Text
26242913 phosphorylation of PAGE4 leads to conformational shifts
24559171 PAGE4, a regulator of c-Jun transactivation, is phosphorylated by homeodomain-interacting protein kinase 1.
24263171 Data suggest that disrupting prostate-associated gene 4 (PAGE4)/c-Jun interaction using small molecules could be a novel strategy to treat prostate cancer.
22885105 Dysregulation of epithelial PAGE4 modulates AR signaling.
21357425 PAGE4 is a highly intrinsically disordered protein with an anti-apoptotic function
15362791 These results suggest that GAGE gene might have an important role in the development and progression of intestinal type of stomach cancer and the detection of GAGE mRNA may be eligible to the panel of molecular markers for aggressive behavior.
12489849 PAGE4 mRNA is expressed only in the cytoplasm of epithelial cells of normal and prostate-cancer specimens

AA Sequence

MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEK      1 - 70
TRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP                                           71 - 102
//

Text Mined References (14)

PMID Year Title
26242913 2015 Phosphorylation-induced Conformational Ensemble Switching in an Intrinsically Disordered Cancer/Testis Antigen.
24559171 2014 Cancer/testis antigen PAGE4, a regulator of c-Jun transactivation, is phosphorylated by homeodomain-interacting protein kinase 1, a component of the stress-response pathway.
24263171 2014 The Stress-response protein prostate-associated gene 4, interacts with c-Jun and potentiates its transactivation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22885105 2012 PAGE4 positivity is associated with attenuated AR signaling and predicts patient survival in hormone-naive prostate cancer.
21357425 2011 The cancer/testis antigen prostate-associated gene 4 (PAGE4) is a highly intrinsically disordered protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15362791 The expression of GAGE gene can predict aggressive biologic behavior of intestinal type of stomach cancer.
More...