Property Summary

Ligand Count 2
NCBI Gene PubMed Count 36
PubMed Score 45.81
PubTator Score 13.12

Knowledge Summary

Patent (3,045)

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.500 4.7e-02
acute quadriplegic myopathy 2.162 6.0e-08
ependymoma 1.600 1.7e-05
group 4 medulloblastoma -1.500 1.1e-02
intraductal papillary-mucinous adenoma (... 2.200 2.3e-02
intraductal papillary-mucinous carcinoma... 2.200 3.8e-02
intraductal papillary-mucinous neoplasm ... 4.200 6.0e-03
lung cancer -1.800 6.2e-04
medulloblastoma, large-cell -1.700 1.1e-02
non-small cell lung cancer -1.155 1.4e-11
osteosarcoma 1.152 1.4e-06
ovarian cancer 1.300 1.4e-03
psoriasis 1.800 1.0e-03
spina bifida -2.101 4.7e-02
subependymal giant cell astrocytoma 1.649 4.0e-02
ulcerative colitis -1.500 1.1e-05

 GO Component (1)

Gene RIF (12)

AA Sequence

MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTK      1 - 70
VFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMI     71 - 140
LNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYD    141 - 210
KDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQ    211 - 280
FAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFAL    281 - 350
RDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI    351 - 420
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLK    421 - 490
PLSPLRAQDMQEGAD                                                           491 - 505
//

Text Mined References (44)

PMID Year Title