Property Summary

NCBI Gene PubMed Count 35
PubMed Score 45.26
PubTator Score 13.12

Knowledge Summary

Patent (3,045)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.41656380846494E-11
posterior fossa group B ependymoma 1530 4.08000357435393E-9
acute quadriplegic myopathy 1157 5.95699077630266E-8
ulcerative colitis 2087 1.14797800612929E-5
osteosarcoma 7933 7.24445022068369E-5
lung cancer 4473 6.23338028178651E-4
psoriasis 6685 0.00100188618614258
ovarian cancer 8492 0.00140022312063685
medulloblastoma 1524 0.00272519219386222
subependymal giant cell astrocytoma 2287 0.00355770299899716
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00601970007053544
medulloblastoma, large-cell 6234 0.0114973687814647
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0225940629910578
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0377182885531382
acute myeloid leukemia 785 0.0467956387745801
spina bifida 1064 0.047178380685587

Expression

Synonym

Accession O60825 O60824 Q5VVQ3 Q5VVQ4 Q9H3P1 6PF-2-K/Fru-2,6-P2ase 2
Symbols PFK-2/FBPase-2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (11)

PMID Text
25662186 Variation in PFKFB2 appears to reduce PFKFB2 expression in adipose and kidney tissues, and thereby increase risk for adiposity and diabetic nephropathy.
24634222 bifunctionality of PFK-2/FBPase-2 complements the metabolic zonation of the liver by ensuring coherent switching in response to insulin and glucagon.
24568531 Highly expressed PFKFB2 protein is associated with hepatocellular carcinoma.
23457334 amino acids stimulate Fru-2,6-P2 synthesis by Akt-dependent PFKFB2 phosphorylation and activation and show how signaling and metabolism are inextricably linked.
22241065 A persistent increase in 6-phosphofructo-2-kinase produced by a change in PFK-2/FBPase-2 isoform expression that may play an important role in the regulation of muscle glycolysis.
21092265 Suggest that PFKFB2 is not an essential upstream regulator of the anti-leukemic effects of glucocorticoids.
20958264 induction of de novo lipid synthesis by androgen requires transcriptional up-regulation of HK2 and PFKFB2, and phosphorylation of PFKFB2 generated by the PI3K/Akt signal pathway to supply the source for lipogenesis from glucose in prostate cancer cells.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTK      1 - 70
VFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMI     71 - 140
LNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYD    141 - 210
KDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQ    211 - 280
FAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFAL    281 - 350
RDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI    351 - 420
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLK    421 - 490
PLSPLRAQDMQEGAD                                                           491 - 505
//

Text Mined References (43)

PMID Year Title
25662186 2015 A cis-eQTL in PFKFB2 is associated with diabetic nephropathy, adiposity and insulin secretion in American Indians.
24634222 2014 A fundamental trade-off in covalent switching and its circumvention by enzyme bifunctionality in glucose homeostasis.
24568531 2014 MACC1 expression correlates with PFKFB2 and survival in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23457334 2013 Akt-dependent activation of the heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) isoenzyme by amino acids.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22241065 2012 Upregulation of heart PFK-2/FBPase-2 isozyme in skeletal muscle after persistent contraction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21092265 2010 Expression, regulation and function of phosphofructo-kinase/fructose-biphosphatases (PFKFBs) in glucocorticoid-induced apoptosis of acute lymphoblastic leukemia cells.
More...