Property Summary

NCBI Gene PubMed Count 22
PubMed Score 42.86
PubTator Score 30.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 7.5e-05
atypical teratoid / rhabdoid tumor 1.100 7.7e-08
group 3 medulloblastoma 1.100 2.6e-03
lung carcinoma 1.800 6.5e-38
pituitary cancer -2.800 8.3e-04

Gene RIF (14)

AA Sequence

MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRM      1 - 70
FPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPI     71 - 140
SFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYN    141 - 210
PFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCE    211 - 280
HYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGP    281 - 350
SPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVST    351 - 420
WTAVASHPFAGWGGPGAGGHHSPSSLDG                                              421 - 448
//

Text Mined References (22)

PMID Year Title