Property Summary

NCBI Gene PubMed Count 30
PubMed Score 71.34
PubTator Score 33.88

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Protein-protein Interaction (9)

Gene RIF (13)

AA Sequence

MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLA      1 - 70
LTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTI     71 - 140
YEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPI    141 - 210
APTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQL    211 - 280
TEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVR    281 - 350
AGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDI    351 - 420
EQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLF    421 - 490
AL                                                                        491 - 492
//

Text Mined References (42)

PMID Year Title