Tbio | Target of Myb protein 1 |
May be involved in intracellular trafficking. Probable association with membranes.
This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Comments
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
Xenopus | OMA Inparanoid |
C. elegans | OMA Inparanoid |
PMID | Text |
---|---|
26320582 | Tom1 modulates binding of Tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism. |
26007630 | candidate multiple myeloma risk locus |
25588840 | phosphatidylinositol 5-monophosphate (PI5P) enrichment in signaling endosomes prevents endosomal maturation through the recruitment of TOM1, and point to a new function of PI5P in regulating discrete maturation steps in the endosomal system. |
23023224 | It was shown that that myosin VI, in concert with Tom1, plays a crucial role in autophagy. Tom1 was identified as a myosin VI binding partner on endosomes. |
20083669 | TOM1 is a microRNA-126 target that may have an important role in regulating innate immune responses in the cystic fibrosis lung. |
18976975 | Knockdown of target of myb1 (TOM1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication |
17671966 | A 3-marker haplotype of SNPs within TOM1 was associated with psychotic bipolar affective disorder linkage |
17671966 | Observational study of gene-disease association. (HuGE Navigator) |
15657082 | The results suggest that TOM1 is an important molecule for membrane recruitment of clathrin, and that endofin is able to exploit this recruitment at the endosome. |
15047686 | Tollip and Tom1 form a complex and regulate endosomal trafficking of ubiquitinated proteins |
More... |
MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLA 1 - 70 LTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTI 71 - 140 YEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPI 141 - 210 APTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQL 211 - 280 TEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVR 281 - 350 AGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDI 351 - 420 EQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLF 421 - 490 AL 491 - 492 //
PMID | Year | Title |
---|---|---|
26320582 | 2015 | Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism. |
26007630 | 2015 | Variants in ELL2 influencing immunoglobulin levels associate with multiple myeloma. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25588840 | 2015 | TOM1 is a PI5P effector involved in the regulation of endosomal maturation. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24097068 | 2013 | Discovery and refinement of loci associated with lipid levels. |
23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
23023224 | 2012 | Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. |
More... |