Property Summary

NCBI Gene PubMed Count 29
Grant Count 6
R01 Count 6
Funding $337,415.33
PubMed Score 67.60
PubTator Score 33.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Photosensitive epilepsy 8 3.674 1.8

Expression

Gene RIF (12)

PMID Text
26320582 Tom1 modulates binding of Tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism.
26007630 candidate multiple myeloma risk locus
25588840 phosphatidylinositol 5-monophosphate (PI5P) enrichment in signaling endosomes prevents endosomal maturation through the recruitment of TOM1, and point to a new function of PI5P in regulating discrete maturation steps in the endosomal system.
23023224 It was shown that that myosin VI, in concert with Tom1, plays a crucial role in autophagy. Tom1 was identified as a myosin VI binding partner on endosomes.
20083669 TOM1 is a microRNA-126 target that may have an important role in regulating innate immune responses in the cystic fibrosis lung.
18976975 Knockdown of target of myb1 (TOM1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
17671966 A 3-marker haplotype of SNPs within TOM1 was associated with psychotic bipolar affective disorder linkage
17671966 Observational study of gene-disease association. (HuGE Navigator)
15657082 The results suggest that TOM1 is an important molecule for membrane recruitment of clathrin, and that endofin is able to exploit this recruitment at the endosome.
15047686 Tollip and Tom1 form a complex and regulate endosomal trafficking of ubiquitinated proteins
More...

AA Sequence

MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLA      1 - 70
LTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTI     71 - 140
YEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPI    141 - 210
APTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQL    211 - 280
TEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVR    281 - 350
AGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDI    351 - 420
EQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLF    421 - 490
AL                                                                        491 - 492
//

Text Mined References (40)

PMID Year Title
26320582 2015 Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
26007630 2015 Variants in ELL2 influencing immunoglobulin levels associate with multiple myeloma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25588840 2015 TOM1 is a PI5P effector involved in the regulation of endosomal maturation.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023224 2012 Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome.
More...