Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.4444029067044E-20
posterior fossa group A ependymoma 1511 7.11145276471059E-8
psoriasis 6685 1.0640539928613E-7
malignant mesothelioma 3163 8.75158405816434E-7
ovarian cancer 8492 3.39359313389817E-5
osteosarcoma 7933 3.63052395732881E-5
cystic fibrosis 1670 1.01885126238399E-4
lung cancer 4473 0.00345545375797065
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00490550541313097
acute myeloid leukemia 785 0.00567618490906407
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00580272947874586
Multiple myeloma 1328 0.0206384343477624

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.122 0.021
malignant mesothelioma -1.600 0.000
psoriasis -1.200 0.000
osteosarcoma -1.580 0.000
posterior fossa group A ependymoma 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.032 0.006
non-small cell lung cancer -1.231 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.005
lung cancer 1.500 0.003
cystic fibrosis -1.200 0.000
acute myeloid leukemia -1.600 0.006
ovarian cancer 2.400 0.000

Synonym

Accession O60783 Q5R358 MRP-S14
Symbols S14mt
MRP-S14
HSMRPS14
DJ262D12.2

Gene

PDB

3J9M  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDV      1 - 70
ADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW                 71 - 128
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
More...