Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.122 0.021
malignant mesothelioma -1.600 0.000
psoriasis -1.200 0.000
osteosarcoma -1.580 0.000
posterior fossa group A ependymoma 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.032 0.006
non-small cell lung cancer -1.231 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.005
lung cancer 1.500 0.003
cystic fibrosis -1.200 0.000
acute myeloid leukemia -1.600 0.006
ovarian cancer 2.400 0.000

Synonym

Accession O60783 Q5R358 MRP-S14
Symbols S14mt
MRP-S14
HSMRPS14
DJ262D12.2

Gene

PDB

3J9M  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDV      1 - 70
ADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW                 71 - 128
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
More...