Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.600 5.7e-03
cystic fibrosis -1.200 1.0e-04
ependymoma 1.100 2.7e-08
intraductal papillary-mucinous adenoma (... 1.300 4.9e-03
lung cancer 1.500 3.5e-03
malignant mesothelioma -1.600 8.8e-07
Multiple myeloma 1.122 2.1e-02
non-small cell lung cancer -1.231 4.4e-20
osteosarcoma -1.580 3.6e-05
ovarian cancer -2.200 2.1e-09
pancreatic ductal adenocarcinoma liver m... -1.032 5.8e-03
psoriasis -1.200 1.1e-07

Gene RIF (1)

AA Sequence

MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDV      1 - 70
ADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW                 71 - 128
//

Text Mined References (15)

PMID Year Title