Property Summary

NCBI Gene PubMed Count 57
PubMed Score 109.11
PubTator Score 99.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.137 3.6e-03
chronic rhinosinusitis -1.973 1.1e-02
cystic fibrosis and chronic rhinosinusit... -1.658 4.9e-02
dermatomyositis 1.600 9.2e-03
Duchenne muscular dystrophy -1.012 1.2e-03
interstitial cystitis -1.300 6.6e-04
interstitial lung disease -2.300 1.5e-02
intraductal papillary-mucinous adenoma (... -1.300 1.1e-02
invasive ductal carcinoma 1.200 4.6e-02
limb girdle muscular dystrophy 2A -1.048 2.4e-03
lung adenocarcinoma -1.600 9.6e-09
lung cancer -1.300 4.2e-04
non-small cell lung cancer -1.284 1.2e-10
periodontitis -1.100 6.2e-24
pituitary cancer -1.200 7.1e-03
spina bifida -2.601 3.3e-02

Protein-protein Interaction (3)

Gene RIF (40)

AA Sequence

MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGPDKNLTEREVF      1 - 70
NEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQGLLAIQFLEFFYGIATATEIA     71 - 140
YYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILVSVAGWSLFSLNVISLTCVSVAFAVAWFLPM    141 - 210
PQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLK    211 - 280
VLWNDFLMCYSSRPLLCWSVWWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFA    281 - 350
VGYIKISWSTWGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERY    351 - 420
ALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMKKCRKLEDPQS    421 - 490
SSQVTTS                                                                   491 - 497
//

Text Mined References (60)

PMID Year Title