Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.40
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Synonym

Accession O60774
Symbols FMO6

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
19898482 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKRVGIIGAGVSGLAAIWCCLEEGLEPTCFERSDDVGGLWKFSDHTEEGRASIYQSVFTNSSKEMMCFP      1 - 70
DFPYPDDYPNYIHHSKLQEYIKTYAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIF     71 - 140
DAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDYKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQV    141 - 210
IISTRSASWVMSRVWDDGYPWDMMYVTRFASFLRNVLPSFISDWLYVQKMNTWFKHENYGLMPLNGSLRK    211 - 280
EPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSVIFATGYDYSYPFLDETIMKSRNNEV    281 - 350
TLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGKKLKCM    351 - 420
FSSFFMFGQSQTLQTDYITYVDELGSFIGAKPNIPWLFLTDPRLALEVYFGPCSPYQFRLMGPGKWDGAR    421 - 490
NAILTQWNRTVKPTRTRVVSEVQRPHPFYNLLKMLSFPLLLLAVTLTFY                         491 - 539
//

Text Mined References (6)

PMID Year Title
22903471 2013 Genome-wide association identifies genetic variants associated with lentiform nucleus volume in N?=?1345 young and elderly subjects.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15077013 2004 Organization and evolution of the flavin-containing monooxygenase genes of human and mouse: identification of novel gene and pseudogene clusters.
12527699 2003 Identification of novel variants of the flavin-containing monooxygenase gene family in African Americans.
12130684 2002 Alternative processing of the human FMO6 gene renders transcripts incapable of encoding a functional flavin-containing monooxygenase.