Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.90
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Lung squamous cell carcinoma 10 3.424 1.7

Gene RIF (2)

AA Sequence

MSKRVGIIGAGVSGLAAIWCCLEEGLEPTCFERSDDVGGLWKFSDHTEEGRASIYQSVFTNSSKEMMCFP      1 - 70
DFPYPDDYPNYIHHSKLQEYIKTYAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIF     71 - 140
DAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDYKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQV    141 - 210
IISTRSASWVMSRVWDDGYPWDMMYVTRFASFLRNVLPSFISDWLYVQKMNTWFKHENYGLMPLNGSLRK    211 - 280
EPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSVIFATGYDYSYPFLDETIMKSRNNEV    281 - 350
TLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGKKLKCM    351 - 420
FSSFFMFGQSQTLQTDYITYVDELGSFIGAKPNIPWLFLTDPRLALEVYFGPCSPYQFRLMGPGKWDGAR    421 - 490
NAILTQWNRTVKPTRTRVVSEVQRPHPFYNLLKMLSFPLLLLAVTLTFY                         491 - 539
//

Text Mined References (7)

PMID Year Title