Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 5
Funding $677,361.5
PubMed Score 10.54
PubTator Score 8.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.041
cystic fibrosis -1.400 0.000
acute myeloid leukemia -1.200 0.011

Gene RIF (3)

PMID Text
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
19460752 Knockdown of zinc finger protein 354A (ZNF354A; TCF17) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of zinc finger protein 354A (ZNF354A; TCF17) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAAGQREARPQVSLTFEDVAVLFTRDEWRKLAPSQRNLYRDVMLENYRNLVSLGLPFTKPKVISLLQQGE      1 - 70
DPWEVEKDGSGVSSLGSKSSHKTTKSTQTQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKG     71 - 140
SFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPREKTPPKCEIQGNSLKQNSQLLNQPKITA    141 - 210
DKRYKCSLCEKTFINTSSLRKHEKNHSGEKLFKCKECSKAFSQSSALIQHQITHTGEKPYICKECGKAFT    211 - 280
LSTSLYKHLRTHTVEKSYRCKECGKSFSRRSGLFIHQKIHAEENPCKYNPGRKASSCSTSLSGCQRIHSR    281 - 350
KKSYLCNECGNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFT    351 - 420
SISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTG    421 - 490
ERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQHRRIHTGEKPFKCNTCGKTFR    491 - 560
QSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKIHIEEDP                             561 - 605
//

Text Mined References (10)

PMID Year Title
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10842194 2000 The tcf17 gene at chromosome 5q is not involved in the development of conventional renal cell carcinoma.
9919311 1998 Molecular cloning of a zinc finger gene eZNF from a human inner ear cDNA library, and in situ expression pattern of its mouse homologue in mouse inner ear.
9465904 1997 Cloning, expression and mapping of a novel human zinc-finger gene TCF17 homologous to rodent Kid1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8382778 1993 Kid-1, a putative renal transcription factor: regulation during ontogeny and in response to ischemia and toxic injury.