Property Summary

Ligand Count 77
NCBI Gene PubMed Count 32
PubMed Score 4712.90
PubTator Score 108.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease -1.757 3.4e-02
adult high grade glioma 1.200 3.1e-03
Astrocytoma, Pilocytic 1.600 7.5e-08
Atopic dermatitis -1.600 1.1e-05
colon cancer -1.300 3.6e-02
ductal carcinoma in situ -1.300 3.4e-03
glioblastoma 2.200 3.0e-02
group 3 medulloblastoma -1.200 3.8e-03
intraductal papillary-mucinous adenoma (... -1.100 1.6e-02
intraductal papillary-mucinous carcinoma... -1.800 3.2e-04
intraductal papillary-mucinous neoplasm ... -1.500 7.5e-03
invasive ductal carcinoma 1.417 2.1e-03
lung adenocarcinoma -1.400 1.2e-07
lung cancer -1.900 7.0e-04
lung carcinoma -2.400 2.3e-17
non-small cell lung cancer -2.628 2.0e-26
oligodendroglioma -1.200 1.5e-02
osteosarcoma -1.413 3.3e-02
psoriasis -1.400 6.0e-07
subependymal giant cell astrocytoma 2.648 7.4e-03
uncontrolled asthma 1.300 2.5e-03

 GO Component (2)

Gene RIF (18)

AA Sequence

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARY      1 - 70
LTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREW     71 - 140
LIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL               141 - 199
//

Text Mined References (36)

PMID Year Title