Property Summary

NCBI Gene PubMed Count 30
PubMed Score 4165.29
PubTator Score 108.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.01057765837892E-26
lung carcinoma 2844 2.29161137132478E-17
pilocytic astrocytoma 3086 7.73600992591958E-8
lung adenocarcinoma 2714 1.24227706989354E-7
psoriasis 6685 5.99878169277102E-7
lung cancer 4473 1.18260931761366E-6
Atopic dermatitis 944 1.12645331074614E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.19055101709402E-4
pediatric high grade glioma 2712 0.00134524684639995
invasive ductal carcinoma 2950 0.00209867293023
uncontrolled asthma 67 0.00249713758977724
ductal carcinoma in situ 1745 0.00335306842603109
group 3 medulloblastoma 2254 0.00376579538106685
subependymal giant cell astrocytoma 2287 0.00744577573133703
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00749275466452919
oligodendroglioma 2849 0.0149635853775154
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0159883136040879
glioblastoma 5572 0.0304899834078098
osteosarcoma 7933 0.0326764357794676
active Crohn's disease 918 0.0344414214904648
colon cancer 1475 0.0361202743536792

Expression

Synonym

Accession O60760 Q6FHT9 H-PGDS
Symbols GSTS
PGD2
PGDS
GSTS1
GSTS1-1

Gene

PDB

1IYH   1IYI   1V40   2CVD   2VCQ   2VCW   2VCX   2VCZ   2VD0   2VD1   3EE2   3KXO   3VI5   3VI7   4EC0   4EDY   4EDZ   4EE0   5AIS   5AIV   5AIX  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
C. elegans OMA EggNOG

 GO Component (2)

Gene RIF (16)

PMID Text
24996417 The effect of C. molle alkaloid extract on H-PGDS was studied. The alkaloid extract exhibited a 70% inhibition on H-PGDS with an IC50 of 13.7 mug/ml.
22049022 COX-1 and H-PGDS were rapidly ubiquitinated and degraded through the ubiquitin-proteasome system in response to the elevation of the intracellular calcium level
21821144 the Val187Ile HPGDS isoenzyme common among African Americans is not associated with colorectal cancer risk
21683347 In patients with mixed atrophy, testicular mast cell numbers and phenotypes change with respect to the ability to express COX2 and PGDS-H.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20074808 Results describe the activation by Mg++ of human hematopoietic prostaglandin D(2) synthase, using Raman spectroscopy.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19276290 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19181746 PU.1 cooperates with MAPK-activated cJun to maximally induce L-PGDS expression in macrophages.
More...

AA Sequence

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARY      1 - 70
LTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREW     71 - 140
LIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL               141 - 199
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24996417 2014 Inhibition of hematopoietic prostaglandin D2 synthase (H-PGDS) by an alkaloid extract from Combretum molle.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
22049022 2012 Rapid degradation of cyclooxygenase-1 and hematopoietic prostaglandin D synthase through ubiquitin-proteasome system in response to intracellular calcium level.
21821144 2012 Hematopoietic prostaglandin D synthase (HPGDS): a high stability, Val187Ile isoenzyme common among African Americans and its relationship to risk for colorectal cancer.
21683347 2011 Mast cells in human testicular biopsies from patients with mixed atrophy: increased numbers, heterogeneity, and expression of cyclooxygenase 2 and prostaglandin D2 synthase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20074808 2010 UV resonance Raman studies on the activation mechanism of human hematopoietic prostaglandin D(2) synthase by a divalent cation, Mg(2+).
19939518 2010 Identification and characterisation of new inhibitors for the human hematopoietic prostaglandin D2 synthase.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...